DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and CYP11B2

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_000489.3 Gene:CYP11B2 / 1585 HGNCID:2592 Length:503 Species:Homo sapiens


Alignment Length:455 Identity:113/455 - (24%)
Similarity:182/455 - (40%) Gaps:84/455 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 WLKELR------------EKH------GPVFRIWFGKDLMVMFTDPEDIKQLLGNNQLLTKSRNY 101
            ||:.|:            |.|      ||:||...|...||....|||:::|   .|:.:.....
Human    49 WLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKL---QQVDSLHPCR 110

  Fly   102 ELLEPWLGK--------GLLTNGGESWHRRR-----KLLTPGFHFRILSEFKEPMEENCRILVRR 153
            .:||||:..        |:....|..|...|     .:|:|....|.|........:..:.|.::
Human   111 MILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKK 175

  Fly   154 LRTKANGE-SFDIYPYITLFALD----AICETAMGIKKHAQLQSDSEYVQAVQSICRVMHK---- 209
            :...|.|. :.|:.|.|..:.::    |:....:|:..|:...:...::.|::    ||.|    
Human   176 VLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALE----VMFKSTVQ 236

  Fly   210 -----QSFSFWQRLNVFFKHTKPGKEREAALKVLHDETNRVIRLRREQLIQERNEWKPEAEQDDV 269
                 :|.|.|....|:       ||...|...:....:..|    :::.||....:|:.....|
Human   237 LMFMPRSLSRWISPKVW-------KEHFEAWDCIFQYGDNCI----QKIYQELAFNRPQHYTGIV 290

  Fly   270 GAKRRLAFLDMLLLTQMEGGAELSDTDIREEVDTFMFEGHDTTSSAIAFALSLLSKNPDVQQRAF 334
            .        ::||      .||||...|:...........|||:..:...|..|::||||||...
Human   291 A--------ELLL------KAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILR 341

  Fly   335 EEA-------SELEGREKESMPYLEAVIKETLRIYPSVPFFSRKVLEDLEVGKLTVPKGASISCL 392
            :|:       ||...:....:|.|.|.:|||||:||...|..|.|..||.:....:|.|..:...
Human   342 QESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVF 406

  Fly   393 IYMLHRDPKNFPDPERFDPDRFLVNEKQMHPFAFAAFSAGPRNCIGQKFAMLELKTSLAMLLRSY 457
            :|.|.|:...||.|||::|.|:|........|....|..|.|.|:|::.|..|:...|..:|:.:
Human   407 LYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHF 471

  Fly   458  457
            Human   472  471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 113/455 (25%)
CYP11B2NP_000489.3 p450 42..454 CDD:365848 109/436 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.