DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and cyp-31A5

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001343697.1 Gene:cyp-31A5 / 13198891 WormBaseID:WBGene00013381 Length:308 Species:Caenorhabditis elegans


Alignment Length:219 Identity:76/219 - (34%)
Similarity:116/219 - (52%) Gaps:16/219 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 IWFGKDLMVMFTDPEDIKQLLGNNQLLTKSRNYELLEPWLGKGLLTNGGESWHRRRKLLTPGFHF 133
            :|.|....:|....:.::.:..:.:.|.|...|.|||||||..:||:..|.|..:||||||.||:
 Worm    74 LWIGPFPCLMLYSADLVEPIFSSTKHLNKGFAYVLLEPWLGISILTSQKEQWRPKRKLLTPTFHY 138

  Fly   134 RILSEFKEPMEENCRILVRRL-RTKANGESFDIYPYITLFALDAICETAMGIKKHAQLQSDSEYV 197
            .||.:|.....|..:||:::| ......|..|:...|||..||.||||:||....|||..::|||
 Worm   139 DILKDFLPIFNEQSKILIQKLCCLGVADEEVDVLSVITLCTLDIICETSMGKAIGAQLAENNEYV 203

  Fly   198 QAVQSICRVMHKQSFS--FWQRLNVFFKHTKPGKEREAALKVLHDETNRVIRLRREQLIQERNEW 260
            .||.:|.:::.|::.:  .|.  :..:..|:.|:..|..|.:|||.|.:||..|:|.|  :.:::
 Worm   204 WAVHTINKLISKRTNNPLMWN--SFIYNLTEDGRTHEKCLHILHDFTKKVIVERKEAL--QDSDY 264

  Fly   261 KPEAEQDDVGAKRRLAFLDMLLLT 284
            |.|.         ||||...:..|
 Worm   265 KMEG---------RLAFSRQICCT 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 76/219 (35%)
cyp-31A5NP_001343697.1 p450 36..>261 CDD:325183 69/190 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.