DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and AgaP_AGAP005992

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_316034.4 Gene:AgaP_AGAP005992 / 1276664 VectorBaseID:AGAP005992 Length:517 Species:Anopheles gambiae


Alignment Length:526 Identity:126/526 - (23%)
Similarity:204/526 - (38%) Gaps:114/526 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LPGPT----IGEL------IANVKKGEILNWLKELREKHGPVFRIWF--GKDLMVMFTDPEDIKQ 87
            :|||.    :|.|      |......|:....::...::|.:.|...  |:|::.:: ||:|:..
Mosquito    32 IPGPRGPLGLGNLYQYIPGIGRYSFDELHRSGEDKYRQYGSIVRETMVPGQDIVWLY-DPDDVAT 95

  Fly    88 LLGNNQ--LLTKSRNYELLEP--------WLGKGLL-TNGGESWHRRRKLLTPGFHFRILSEFKE 141
            :|.:..  :....|::..||.        :...||| |||.|.|..|.:|.......:.:..|..
Mosquito    96 VLDDRTPGMYPSRRSHTALEKYRKDRPNVYRTAGLLPTNGAEWWKIRSELQKGLSSPQNVRNFLP 160

  Fly   142 PMEENCRILVRRLRTKAN-GESF---DIYPYITLFALDAICETAMGIK--KHAQLQSD-----SE 195
            ..::..:..|.|||.:.. |:|.   |..|.::...|:.||..|..::  ..::.|.|     |.
Mosquito   161 ATDKITKEFVTRLRAQMEPGKSILIEDFMPLVSRLNLELICLLAFDVRLDSFSEEQMDPGSLSSR 225

  Fly   196 YVQAVQSI--CRVMHKQSFSFWQRLNVFFKHTKPGKEREAALKVLHDETNRVIRLRREQLIQER- 257
            .:::.::.  |.:...|.|..|:    :|                  ||....|||:.|...|: 
Mosquito   226 LMESAETTNSCILPTDQGFQLWR----YF------------------ETPAYRRLRKAQEFMEKT 268

  Fly   258 ------------NEWKPEAEQDDVGAKRRLAFLDMLLLTQMEGGAELSDTDIREEVDTFMFEGHD 310
                        ||.:......:.|:|.        |:.:......|...||.......:..|..
Mosquito   269 AVELVSQKLLYFNEDQQRLASGEHGSKS--------LMEEYLRNPNLELNDIIGMASDLLLAGVH 325

  Fly   311 TTSSAIAFALSLLS-KNPDVQQRAFEEASEL--EGREK--------ESMPYLEAVIKETLRIYPS 364
            |||...||||..|. .....|.|.:.||.::  :.||.        ....|..||:|||||:.|.
Mosquito   326 TTSYTTAFALYHLGLHGATAQDRLYREAKKILPDPRENRIGAAVLGSEASYCRAVLKETLRLNPI 390

  Fly   365 VPFFSRKVLEDLEVGKLTVPKGA------SISCLIYMLHRDPKNFPDPERFDPDRFLVNEKQ-MH 422
            .....|.:..|..:|...||:|.      .|||      |....|.||:.|.|:|::...|: :|
Mosquito   391 SIGVGRILNRDHVLGGYQVPRGTVIVTQNMISC------RQEAYFRDPQLFLPERWMRETKEPVH 449

  Fly   423 PFAFAAFSAGPRNCIGQKFAMLELKTSLAMLLRSYRF-----LPDKDHQPKPLAELVTKSGNGIR 482
            |.....|..|.|:||.::.|...:...|..|:||:..     :| .|.:.|    |:.:....||
Mosquito   450 PHLVLPFGHGMRSCIARRLAEQSMLVLLLRLIRSFEIEWAGTVP-MDVKTK----LINQPDQPIR 509

  Fly   483 LRILPR 488
            ||:..|
Mosquito   510 LRMKAR 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 119/505 (24%)
AgaP_AGAP005992XP_316034.4 p450 33..487 CDD:299894 117/490 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.