DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and AgaP_AGAP012855

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_306845.4 Gene:AgaP_AGAP012855 / 1268287 VectorBaseID:AGAP012855 Length:351 Species:Anopheles gambiae


Alignment Length:330 Identity:94/330 - (28%)
Similarity:153/330 - (46%) Gaps:54/330 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 ESFDIYPYITLFALDAICETAMGIKKHAQLQSDSEYVQAVQSICRVMHKQSFSF--WQRLNVFFK 223
            :..||...:..|..|.|...|.||:.:.....:|::        |:|.|:..:.  .:.|.||| 
Mosquito    16 QRIDIKELLARFMTDVIGSCAFGIECNTLENPNSQF--------RLMGKRMINLPKLKSLKVFF- 71

  Fly   224 HTKPGKEREAALKVLHDETN------RVIRLRREQLIQERNEWKPEAEQDDVGAKRRLAFLDMLL 282
             ....:::..||.:.:::.:      .|:|    ..|:.|.|          ...||..|:.:|:
Mosquito    72 -AMMFRKQAQALGIRYNDKDVADFFMNVVR----DTIRYRAE----------NGVRRDDFMQLLI 121

  Fly   283 LTQMEGGA----ELSDTDIREEVDTFMFEGHDTTSSAIAFALSLLSKNPDVQQRA--------FE 335
            ....|.||    .|:..:|..:...|.|.|.:|:::.:.|||.||:::|..|::|        .:
Mosquito   122 DMMQENGAGAGESLTFEEIAAQAFVFFFGGFETSTTTLTFALHLLAQHPKAQRKARKCVRSTLAK 186

  Fly   336 EASELEGREKESMPYLEAVIKETLRIYPSVPFFSRKVLEDLEV--GKLTVPKGASISCLIYMLHR 398
            ..:|:.....:.|.|||.||.||||:||.|....|...:..::  |:: :|:|..:.........
Mosquito   187 HGNEMTYEAIKDMYYLECVIHETLRLYPPVASIHRMTSQPYQLPNGEV-IPEGVGVIISNLAFQH 250

  Fly   399 DPKNFPDPERFDPDRFLVNEK---QMHPFAFAAFSAGPRNCIGQKFAMLELKTSLAMLLRSYRF- 459
            ||..||||..|.|:||  .:|   :.:| ::.||..|||.||..:|..|:....|||||:||.| 
Mosquito   251 DPTLFPDPLAFKPERF--EDKTFAKTNP-SYLAFGDGPRMCIAMRFGKLQTCLGLAMLLKSYTFS 312

  Fly   460 LPDKD 464
            |.|.|
Mosquito   313 LEDCD 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 94/330 (28%)
AgaP_AGAP012855XP_306845.4 p450 <16..326 CDD:299894 94/330 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.