DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and Cyp4f15

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_598888.1 Gene:Cyp4f15 / 106648 MGIID:2146921 Length:534 Species:Mus musculus


Alignment Length:510 Identity:170/510 - (33%)
Similarity:264/510 - (51%) Gaps:75/510 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 WAAFLRYLPKILNFLRLQRFAKTLPGPT------IGELIANVKKGEILNWLKELREKHGPVFRIW 70
            |..||.:|..|.              ||      :..|:|...:| .:.||       ||:..| 
Mouse    62 WNWFLGHLGMIT--------------PTEHGLKEVTNLVATYPQG-FMTWL-------GPIIPI- 103

  Fly    71 FGKDLMVMFTDPEDIKQLLGNNQ--LLTKSRNYELLEPWLGKGLLTNGGESWHRRRKLLTPGFHF 133
                  :....|:.|:.:|..:.  .|.:...|..|:||||.|||.:.|:.|...|::|||.|||
Mouse   104 ------ITLCHPDIIRSVLNASASVALKEVVFYSFLKPWLGDGLLLSDGDKWSSHRRMLTPAFHF 162

  Fly   134 RILSEFKEPMEENCRILVRRLRTKANGES--FDIYPYITLFALDAICETAMGIKKHAQLQSDSEY 196
            .||..:.:...::..|:..:.:..|:|.|  .|::..|:|..||::.:.......:.| ::.|||
Mouse   163 NILKPYVKIFNDSTNIMHAKWQHLASGGSARLDVFENISLMTLDSLQKCVFSFDSNCQ-ENPSEY 226

  Fly   197 VQAVQSICRVMHKQSFSFWQRLNVFFKHTKPGKEREAALKVLHDETNRVIRLRREQLIQERNEWK 261
            :.|:..:..::.|:.......::..::.|..|:....|..::|..|:.||:.||..|        
Mouse   227 ISAILELSALVTKRYHQLLLHIDSLYQLTCSGRRFHKACHLVHSFTDAVIQDRRRTL-------- 283

  Fly   262 PEAEQDDV----GAKRRLAFLDMLLLTQMEGGAELSDTDIREEVDTFMFEGHDTTSSAIAFALSL 322
            |...:|||    ...:.|.|:|:|||::.|.|.||||.|||.|.|||||||||||:|.:::.|..
Mouse   284 PSKHEDDVLKAKAKSKTLDFIDVLLLSKDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWILYN 348

  Fly   323 LSKNPDVQQRAFEEASELEGREKES-----------------MPYLEAVIKETLRIYPSVPFFSR 370
            |:::|:.|:|..:|..||. |::||                 :|:|...|||:||::|.|...||
Mouse   349 LARHPEYQERCRQEVQELL-RDRESTEIECSCAVFLRDDLAQLPFLTMCIKESLRLHPPVTVISR 412

  Fly   371 KVLEDLEV--GKLTVPKGASISCLIYMLHRDPKNFPDPERFDPDRF-LVNEKQMHPFAFAAFSAG 432
            :..:|:.:  |:: :|||......|:..|.:|..:||||.:||.|| ..|.|...|.||..||||
Mouse   413 RCTQDIVLPDGRV-IPKGVICIINIFATHHNPTVWPDPEVYDPFRFDPENIKDRSPLAFIPFSAG 476

  Fly   433 PRNCIGQKFAMLELKTSLAMLLRSYRFLPDKDHQPKPLAELVTKSGNGIRLRILP 487
            |||||||.|||.|:|.:||:.|..:|.||| |.:|:...||:.::..|:.||:.|
Mouse   477 PRNCIGQTFAMNEMKVALALTLLRFRVLPD-DKEPRRKPELILRAEGGLWLRVEP 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 159/467 (34%)
Cyp4f15NP_598888.1 p450 57..526 CDD:278495 167/504 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845004
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.