DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and XB980013

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_002931492.1 Gene:XB980013 / 100487918 XenbaseID:XB-GENE-980014 Length:516 Species:Xenopus tropicalis


Alignment Length:508 Identity:176/508 - (34%)
Similarity:273/508 - (53%) Gaps:54/508 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LALVAFVLWAAFLRYLPKILNFLR-------LQRFAKTLPGPTIGELIANVKK--------GEIL 53
            |.|:..:|.|..|        |:|       ||.|    |||....|..|..:        ..||
 Frog    28 LCLILLLLKACGL--------FIRWKSLKDALQNF----PGPPKHWLYGNANQFRNDGTDMDRIL 80

  Fly    54 NWLKELREKHGPVFRIWFGKDL-MVMFTDPEDIKQLLGNNQLLTKSRNYELLEPWLGKGLLTNGG 117
            .|    ..|:...|.:|.|:.. .::.|:||..|.....:...|.: .|:.|.||:|||||...|
 Frog    81 LW----ANKYPKAFPLWVGQFFASLVITNPEYAKAAFARSDPKTPT-GYDFLIPWIGKGLLVLSG 140

  Fly   118 ESWHRRRKLLTPGFHFRILSEFKEPMEENCRILVRRLRTKAN-GESFDIYPYITLFALDAICETA 181
            ::|.:.|:|||||||:.:|..:.:.:.::.::::.:....:| ||..:::.:::|..||:|.:.|
 Frog   141 DTWFQHRRLLTPGFHYDVLKPYAKLISDSTKVMLDKWVPFSNKGEPVELFHHVSLMTLDSIMKCA 205

  Fly   182 MGIKKHAQLQSDSEYVQAVQSICRVMHKQSFSFWQRLNVFFKHTKPGKEREAALKVLHDETNRVI 246
            .....:.|..:|:.|.:||..:..:.|.::.:|....|:.:..:..|.....|.::.|..|::||
 Frog   206 FSYHSNCQTDNDNSYTKAVYDLSYLTHHRARTFPYHNNLIYYLSPHGFLFRKACRIAHQHTDKVI 270

  Fly   247 RLRREQLIQERNEWKPEAEQDDVGAKRRLAFLDMLLLTQMEGGAELSDTDIREEVDTFMFEGHDT 311
            : :|:.|:|.:.|:      :.|..||...|||:||..:.|.|..|||.|:|.||||||||||||
 Frog   271 K-QRKTLLQNKEEF------EKVKQKRHPDFLDILLCARDENGKGLSDEDLRAEVDTFMFEGHDT 328

  Fly   312 TSSAIAFALSLLSKNPDVQQRAFEEASELEGREKES--------MPYLEAVIKETLRIYPSVPFF 368
            |:|.|::.|..::|.|:.||:..||..::.| ||||        :||....|||:||:||.||..
 Frog   329 TASGISWILYCMAKYPEHQQKCREEIRDVLG-EKESFEWEDLNKIPYTTMCIKESLRLYPPVPAV 392

  Fly   369 SRKVLEDLEV--GKLTVPKGASISCLIYMLHRDPKNFPDPERFDPDRF-LVNEKQMHPFAFAAFS 430
            ||::.:.:..  |: ::|.|:.|...|:.:||:|..:.|||.|||.|| ..|..:.|..||..|:
 Frog   393 SRELNKPITFSDGR-SLPAGSVIFINIFCIHRNPTVWKDPEVFDPLRFSSENSSKRHSHAFVPFA 456

  Fly   431 AGPRNCIGQKFAMLELKTSLAMLLRSYRFLPDKDHQPKPLAELVTKSGNGIRL 483
            |||||||||.|||.|||.::|:.|..|...||....|....:||.:|.|||.:
 Frog   457 AGPRNCIGQNFAMNELKVAVALTLNRYELSPDLSKAPLKSPQLVLRSKNGIHV 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 160/454 (35%)
XB980013XP_002931492.1 p450 55..508 CDD:278495 165/466 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.