DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and runx1

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_012813452.1 Gene:runx1 / 100485449 XenbaseID:XB-GENE-483164 Length:500 Species:Xenopus tropicalis


Alignment Length:245 Identity:48/245 - (19%)
Similarity:78/245 - (31%) Gaps:84/245 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RFAKTLP--------GPTIGELIANVKKGEILNWLKELREKHGP-------------VFRIWFGK 73
            |..||||        |......:..|..|...|:..|||.....             |.|...||
 Frog    80 RCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGK 144

  Fly    74 DL---MVMFTDPEDIKQLLGNNQLLTKSRNYEL------------LEPWLGKGLLTNGGESWHRR 123
            ..   :.:||:|.         |:.|..|..::            .:|.:|.||:  ||:.....
 Frog   145 SFTLTITVFTNPP---------QVATYHRAIKITVDGPREPRRPKYDPIIGPGLV--GGQIQAEI 198

  Fly   124 RKLLTPG--FHFRILSEF---KEPMEENCRILVRRLRTKANGESFDIYPYITLFALDAICETAMG 183
            ..:.:.|  .....:..|   ::.::|         :||:...||.    ..|..|:.:..|||.
 Frog   199 YSIYSLGKSADSSCVGSFTGHRQKLDE---------QTKSGTLSFS----ERLSELEHLRRTAMR 250

  Fly   184 IKKH-------------------AQLQSDSEYVQAVQSICRVMHKQSFSF 214
            :..|                   .|.||..:..:.||:.....:.||:.:
 Frog   251 VSPHHPTPTPNPRATLNHSTAFNPQPQSQIQDTRQVQASPPWSYDQSYQY 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 45/240 (19%)
runx1XP_012813452.1 Runt 58..178 CDD:279225 22/106 (21%)
RunxI 407..500 CDD:285676
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.