DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4s3 and Cyp2c69

DIOPT Version :9

Sequence 1:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001097995.1 Gene:Cyp2c69 / 100043108 MGIID:3721049 Length:491 Species:Mus musculus


Alignment Length:515 Identity:129/515 - (25%)
Similarity:207/515 - (40%) Gaps:100/515 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VAFVLWAAFLRYLPKILNFLRLQRFAK--TLPGPTIGELIAN---VKKGEILNWLKELREKHGPV 66
            |..||..:|:     :|..|..||.|:  ..||||...:|.|   :...:|...|....:.:|||
Mouse     5 VVLVLCLSFM-----LLLSLWRQRSARRNLPPGPTPLPIIGNYHLIDMKDIGQCLTNFSKTYGPV 64

  Fly    67 FRIWFGKDLMVMFTDPEDIKQ-LLGNNQLLTKSRNYELLEP-WLGKGLLTNGGESWHRRRKLLTP 129
            |.::||...:|:....|.||: |:.:.::.:...::...:. ..|||:..:.|..|...|.....
Mouse    65 FTLYFGSQPIVVLHGYEAIKEALIDHGEVFSGRGSFPFFDKVSKGKGIGFSHGNVWKATRVFTVN 129

  Fly   130 GFHFRILSEFKEPME----ENCRILVRRLRTKANGESFDIYPYITLFALDAICETAMGIKKHAQL 190
              ..|.|:..|..:|    |..:.|::.|: |.||...|....|.....:.||..   :.::...
Mouse   130 --TLRNLAMGKRTIENKVQEEAQWLMKELK-KTNGSPCDPQFIIGCAPCNVICSI---VFQNRFD 188

  Fly   191 QSDSEYVQAVQSI-----------CRVMHKQSFSFWQ---RLNVFFK-HT-------KPGKEREA 233
            ..|.:::..:..:           |::.:........   |.|.||| ||       :..||.|.
Mouse   189 YKDKDFLSLIGKVNECTEILSSPGCQIFNAVPILIDYCPGRHNKFFKNHTWIKSYLLEKIKEHEE 253

  Fly   234 ALKVLHDETNRVIRLRREQLIQERNEWKPEAEQDDVGAKRRLAFLDMLLL-TQMEGGAELSDTDI 297
            :|    |.||                     .:|         |:|..|: .:.:.|.|..:..|
Mouse   254 SL----DVTN---------------------PRD---------FIDYFLIQRRQDKGIEHMEYTI 284

  Fly   298 RE---EVDTFMFEGHDTTSSAIAFALSLLSKNPDVQQRAFEEASELEGR-------EKESMPYLE 352
            ..   .|...:|.|.:|.||.:.|||.||.|:..:..:..||...:.||       :::.|||..
Mouse   285 EHLATLVTDLVFGGTETLSSTMRFALLLLMKHTHITAKVQEEIDNVIGRHRSPCMQDRKHMPYTN 349

  Fly   353 AVIKETLRIYPSVP-FFSRKVLEDLEVGKLTVPKGASISCLIYMLHRDPKNFPDPERFDPDRFL- 415
            |::.|..|.....| ....:|..|.:.....:|||..:...:..:..|...||:||.|||..|| 
Mouse   350 AMVHEVQRYVDLGPTSLVHEVTCDTKFRNYFIPKGTQVMTSLSSVLHDSTEFPNPEVFDPGHFLD 414

  Fly   416 --VNEKQMHPFAFAAFSAGPRNCIGQKFAMLELKTSLAMLLRSYRFLP-----DKDHQPK 468
              .|.|:..  .|..||||.|.|:|:..|.:||...|..:|::::..|     |.|..||
Mouse   415 DNGNFKKSD--YFVPFSAGKRICVGESLARMELFLFLTTILQNFKLKPLVDPKDIDTTPK 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 120/485 (25%)
Cyp2c69NP_001097995.1 p450 30..487 CDD:278495 120/485 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.