DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15027 and TMA16

DIOPT Version :9

Sequence 1:NP_572999.1 Gene:CG15027 / 32440 FlyBaseID:FBgn0030611 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_014895.2 Gene:TMA16 / 854426 SGDID:S000005778 Length:178 Species:Saccharomyces cerevisiae


Alignment Length:170 Identity:40/170 - (23%)
Similarity:78/170 - (45%) Gaps:29/170 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTNLRKELEK-----CKHPNSRKTKALGKKARRQNNKHKVRLGHAIKSNITGEKLSWFLGQI--- 57
            ::.|:|.|.|     ..||..||.:.|.:...|::   |:    |.|..:..:|....|.::   
Yeast     7 LSKLQKNLSKKGKNITVHPKGRKYEKLVRATMRED---KI----AAKKKLHQDKRVHELARVKFM 64

  Fly    58 -DEGRTEPLRPQELED------LIELYFTRFDEELEQINLKQSIGKHRANQHAARKDV-ITMTLE 114
             |...::..:.|.:.|      .|:.:..|.|.||:::..|:     |:|:..:.:.| :....:
Yeast    65 QDVVNSDTFKGQPIFDHAHTREFIQSFIERDDTELDELKKKR-----RSNRPPSNRQVLLQQRRD 124

  Fly   115 KERNEFRTGGLELMNLCDPLKLKMLRDWDGSALSVQHLKL 154
            :|..||:.|.| ..:|.|...::.||:|:|:...:..|:|
Yeast   125 QELKEFKAGFL-CPDLSDAKNMEFLRNWNGTFGLLNTLRL 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15027NP_572999.1 DUF2962 9..154 CDD:288077 36/160 (23%)
TMA16NP_014895.2 Tma16 23..167 CDD:402652 36/154 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343582
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006188
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104673
Panther 1 1.100 - - LDO PTHR13349
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4787
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.