DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15027 and Tma16

DIOPT Version :9

Sequence 1:NP_572999.1 Gene:CG15027 / 32440 FlyBaseID:FBgn0030611 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_079741.1 Gene:Tma16 / 66282 MGIID:1913532 Length:221 Species:Mus musculus


Alignment Length:201 Identity:57/201 - (28%)
Similarity:98/201 - (48%) Gaps:32/201 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EKCKHPNSRKTKALGKKARRQNNKHKVRLGHAIKSNITGEKLSWFLGQIDEGRTEPLRPQELEDL 73
            :|..||.|||...:.:::.:|:.|.:::...|::.|:.|:||.||...:|..:|...:....| |
Mouse    14 KKVIHPYSRKAAQITRESHKQDKKERLKTEKALRLNLIGDKLQWFHSHLDMKKTRYSKKDACE-L 77

  Fly    74 IELYFTRFDEELEQINLKQSIGKHRANQHAARKDVITMTLEKERNEFRTGGLELMNLCDPLKLKM 138
            :|.|..||..|||||.|:.||...:..:|.:|:.||..|||:||.::...|.|:.::.|...|:.
Mouse    78 VERYLDRFSSELEQIELQNSIKDRQGRRHHSREAVIKQTLERERQQYEGYGFEIPDILDSNTLQT 142

  Fly   139 LRDWDGSALSVQHLKL------DLV-----SYNMLQ--------------------RLKEQSKKK 172
            .|:||.....:.::|:      |.|     ..|:|.                    :|:..|:..
Mouse   143 FREWDFDLKKLPNIKMRKLCADDAVPKKRKQKNILNIEKDLGELELSGPTGATTDGKLEPASESS 207

  Fly   173 ETSEQM 178
            :|.|:|
Mouse   208 DTDEEM 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15027NP_572999.1 DUF2962 9..154 CDD:288077 47/144 (33%)
Tma16NP_079741.1 DUF2962 13..161 CDD:288077 48/147 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 180..221 5/34 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 97 1.000 Domainoid score I7267
eggNOG 1 0.900 - - E1_2CB2V
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10146
Inparanoid 1 1.050 97 1.000 Inparanoid score I5021
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50066
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006188
OrthoInspector 1 1.000 - - oto94595
orthoMCL 1 0.900 - - OOG6_104673
Panther 1 1.100 - - LDO PTHR13349
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4787
SonicParanoid 1 1.000 - - X5118
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.860

Return to query results.
Submit another query.