Sequence 1: | NP_572999.1 | Gene: | CG15027 / 32440 | FlyBaseID: | FBgn0030611 | Length: | 180 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_079741.1 | Gene: | Tma16 / 66282 | MGIID: | 1913532 | Length: | 221 | Species: | Mus musculus |
Alignment Length: | 201 | Identity: | 57/201 - (28%) |
---|---|---|---|
Similarity: | 98/201 - (48%) | Gaps: | 32/201 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 EKCKHPNSRKTKALGKKARRQNNKHKVRLGHAIKSNITGEKLSWFLGQIDEGRTEPLRPQELEDL 73
Fly 74 IELYFTRFDEELEQINLKQSIGKHRANQHAARKDVITMTLEKERNEFRTGGLELMNLCDPLKLKM 138
Fly 139 LRDWDGSALSVQHLKL------DLV-----SYNMLQ--------------------RLKEQSKKK 172
Fly 173 ETSEQM 178 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15027 | NP_572999.1 | DUF2962 | 9..154 | CDD:288077 | 47/144 (33%) |
Tma16 | NP_079741.1 | DUF2962 | 13..161 | CDD:288077 | 48/147 (33%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 180..221 | 5/34 (15%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 97 | 1.000 | Domainoid score | I7267 |
eggNOG | 1 | 0.900 | - | - | E1_2CB2V | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 1 | 1.000 | - | - | H10146 | |
Inparanoid | 1 | 1.050 | 97 | 1.000 | Inparanoid score | I5021 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG50066 | |
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0006188 | |
OrthoInspector | 1 | 1.000 | - | - | oto94595 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_104673 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR13349 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R4787 |
SonicParanoid | 1 | 1.000 | - | - | X5118 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 1 | 0.960 | - | - | ||
15 | 14.860 |