DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15027 and tma16

DIOPT Version :9

Sequence 1:NP_572999.1 Gene:CG15027 / 32440 FlyBaseID:FBgn0030611 Length:180 Species:Drosophila melanogaster
Sequence 2:XP_012818038.1 Gene:tma16 / 549385 XenbaseID:XB-GENE-1015317 Length:214 Species:Xenopus tropicalis


Alignment Length:181 Identity:61/181 - (33%)
Similarity:104/181 - (57%) Gaps:4/181 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NLRKELEKCKHPNSRKTKALGKKARRQNNKHKVRLGHAIKSNITGEKLSWFLGQIDEGRTEPLRP 67
            |..|:.:|..||.|||...|.::|.:|:.|.:::...|::.:|.||||.||...::..:.|..:.
 Frog    24 NKNKQEKKVIHPYSRKAAQLTREAHKQDRKDRLKNEKALRLSIIGEKLQWFQSHLNPEKEEYTKK 88

  Fly    68 QELEDLIELYFTRFDEELEQINLKQSIGKHRANQHAARKDVITMTLEKERNEFRTGGLELMNLCD 132
            :..| |||.|..|||.|||||.|..:|...:..:|.:|:.||..|:|:||..:...|:|:.::.:
 Frog    89 EACE-LIESYLHRFDSELEQIELHNNIKGRQTRRHGSRETVIKQTIERERQLYSGYGIEIPDIVN 152

  Fly   133 PLKLKMLRDWDGSALSVQHLKLDLVSYNML--QRLKE-QSKKKETSEQMET 180
            ...||:.||||.....:.::|:..:|.:.|  :..|| |...:||.:::|:
 Frog   153 SKNLKVFRDWDLDMKKLPNIKMRKISISDLLSKSGKEVQGGNEETEDKLES 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15027NP_572999.1 DUF2962 9..154 CDD:288077 50/144 (35%)
tma16XP_012818038.1 Tma16 29..178 CDD:371407 51/149 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I7083
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10146
Inparanoid 1 1.050 105 1.000 Inparanoid score I4814
OMA 1 1.010 - - QHG50066
OrthoDB 1 1.010 - - D1541925at2759
OrthoFinder 1 1.000 - - FOG0006188
OrthoInspector 1 1.000 - - oto104793
Panther 1 1.100 - - LDO PTHR13349
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4787
SonicParanoid 1 1.000 - - X5118
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.