DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33177 and Ptges

DIOPT Version :9

Sequence 1:NP_788903.1 Gene:CG33177 / 32438 FlyBaseID:FBgn0053177 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_067594.1 Gene:Ptges / 59103 RGDID:62076 Length:153 Species:Rattus norvegicus


Alignment Length:142 Identity:52/142 - (36%)
Similarity:83/142 - (58%) Gaps:15/142 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLSKSNPVMGCYMFWTSLLVLKMLVMSLLTARQRMKTKTYANPED------LRLSRSTEVRFGDP 77
            |:.:::.|:..::..::|||:||..::::|.:.|::.|.:|||||      |:..||      ||
  Rat     6 LVMENSQVLPAFLLCSTLLVIKMYAVAVITGQVRLRKKAFANPEDALKRGGLQYCRS------DP 64

  Fly    78 NVERVRRAHRNDLENILPFLLMSLAYVASGPNPLTARLLIRIGASARLIHTVVY--AIIP-VPQP 139
            :|||..||||||:|.|.|||.:...|...|||||.|.:...:..:.|::|||.|  .:.| :...
  Rat    65 DVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPLIAWIHFLVVLTGRVVHTVAYLGKMNPRIRSG 129

  Fly   140 ARALAFFTTFAI 151
            |..||.|..|::
  Rat   130 AYVLAQFACFSM 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33177NP_788903.1 MAPEG 30..160 CDD:279468 50/131 (38%)
PtgesNP_067594.1 MAPEG 17..147 CDD:395893 50/131 (38%)
Glutathione binding. /evidence=ECO:0000250|UniProtKB:O14684 74..78 3/3 (100%)
Glutathione binding. /evidence=ECO:0000250|UniProtKB:O14684 127..131 0/3 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340470
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2B1WH
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50114
OrthoDB 1 1.010 - - D1591261at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_113953
Panther 1 1.100 - - O PTHR10689
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.