DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33177 and Mgst1

DIOPT Version :9

Sequence 1:NP_788903.1 Gene:CG33177 / 32438 FlyBaseID:FBgn0053177 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001334418.1 Gene:Mgst1 / 56615 MGIID:1913850 Length:229 Species:Mus musculus


Alignment Length:140 Identity:60/140 - (42%)
Similarity:80/140 - (57%) Gaps:19/140 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 NPVMGCYMFWTSLLVLKMLVMSLLTARQRMKTKTYANPEDLRLSRSTEVRFG-----------DP 77
            |.|:..:..:.::::.||:.||..||.||:..|.:|||||.       ..||           |.
Mouse    84 NEVLMAFTSYATIILTKMMFMSSATAFQRITNKVFANPEDC-------AGFGKGENAKKFVRTDE 141

  Fly    78 NVERVRRAHRNDLENILPFLLMSLAYVASGPNPLTARLLIRIGASARLIHTVVYAIIPVPQPARA 142
            .||||||||.||||||:|||.:.|.|..|||:..||.:..||...||:.||:.| :.|:|||.|.
Mouse   142 KVERVRRAHLNDLENIVPFLGIGLLYSLSGPDLSTALMHFRIFVGARIYHTIAY-LTPLPQPNRG 205

  Fly   143 LAFFTTFAIT 152
            ||||..:.:|
Mouse   206 LAFFVGYGVT 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33177NP_788903.1 MAPEG 30..160 CDD:279468 58/134 (43%)
Mgst1NP_001334418.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836763
Domainoid 1 1.000 109 1.000 Domainoid score I6351
eggNOG 1 0.900 - - E1_2B1WH
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I4794
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50114
OrthoDB 1 1.010 - - D1591261at2759
OrthoFinder 1 1.000 - - FOG0003387
OrthoInspector 1 1.000 - - otm43065
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10689
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3015
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.870

Return to query results.
Submit another query.