DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33177 and ptges

DIOPT Version :9

Sequence 1:NP_788903.1 Gene:CG33177 / 32438 FlyBaseID:FBgn0053177 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001014828.1 Gene:ptges / 544666 ZFINID:ZDB-GENE-050407-2 Length:146 Species:Danio rerio


Alignment Length:117 Identity:45/117 - (38%)
Similarity:75/117 - (64%) Gaps:1/117 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CYMFWTSLLVLKMLVMSLLTARQRMKTKTYANPEDLRLSRSTEVRFGDPNVERVRRAHRNDLENI 93
            |::|:::||:|||.:::::|.:.|::.|.:|||||.......:....||.|||.|||.:||:|||
Zfish     9 CFIFYSTLLILKMYIIAIITGQVRLRKKAFANPEDAERHGGVQFCRTDPYVERCRRAQQNDMENI 73

  Fly    94 LPFLLMSLAYVASGPNPLTARLLIRIGASARLIHTVVYAIIPVPQPARALAF 145
            ||||.:...|..:.|:...|:|...|....|::|:|.| ::.:..|.|:||:
Zfish    74 LPFLFLGAVYSMTSPSYAAAQLHFLIFFLGRVLHSVAY-LLALKAPTRSLAY 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33177NP_788903.1 MAPEG 30..160 CDD:279468 44/116 (38%)
ptgesNP_001014828.1 MAPEG 10..140 CDD:279468 44/116 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580250
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2B1WH
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50114
OrthoDB 1 1.010 - - D1591261at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6396
orthoMCL 1 0.900 - - OOG6_113953
Panther 1 1.100 - - O PTHR10689
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.720

Return to query results.
Submit another query.