DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33177 and mgst1

DIOPT Version :9

Sequence 1:NP_788903.1 Gene:CG33177 / 32438 FlyBaseID:FBgn0053177 Length:167 Species:Drosophila melanogaster
Sequence 2:XP_031753748.1 Gene:mgst1 / 496690 XenbaseID:XB-GENE-5758553 Length:159 Species:Xenopus tropicalis


Alignment Length:138 Identity:52/138 - (37%)
Similarity:82/138 - (59%) Gaps:17/138 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VMGCYMFWTSLLVLKMLVMSLLTARQRMKTKTYANPEDLRLSRSTEVRFGDP--------NVERV 82
            |:..|..:.::::|||::||..||..|...:.:.||||.|.:    .:.|||        :||||
 Frog    16 VLRAYATYATIVLLKMMMMSFATAFYRNTKQVFFNPEDARAA----AKGGDPKKLLKTDEDVERV 76

  Fly    83 RRAHRNDLENILPFLLMSLAYVASGPNPLTARLLIRIGASARLIHTVVYAIIPVPQPARAL---- 143
            ||.|.||:||::||:.:.|.|..:.|:..:|.|..||...:||:|||.| ::|:|||:|.|    
 Frog    77 RRCHLNDIENVVPFVAIGLIYTLTNPDLASALLHFRIFTGSRLLHTVAY-LLPLPQPSRGLMWII 140

  Fly   144 AFFTTFAI 151
            .:|.|.::
 Frog   141 GYFATISM 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33177NP_788903.1 MAPEG 30..160 CDD:279468 51/134 (38%)
mgst1XP_031753748.1 MAPEG 20..154 CDD:395893 51/134 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1591261at2759
OrthoFinder 1 1.000 - - FOG0003387
OrthoInspector 1 1.000 - - mtm9476
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3015
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.