DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33177 and mgst1.1

DIOPT Version :9

Sequence 1:NP_788903.1 Gene:CG33177 / 32438 FlyBaseID:FBgn0053177 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001005957.1 Gene:mgst1.1 / 449784 ZFINID:ZDB-GENE-041010-30 Length:154 Species:Danio rerio


Alignment Length:136 Identity:54/136 - (39%)
Similarity:84/136 - (61%) Gaps:6/136 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 WTSLLVLKMLVMSLLTARQRMKTKTYANPEDLRLSRSTE----VRFGDPNVERVRRAHRNDLENI 93
            :.::::|||::|||:|:..|:..:.::|.||..::.:.:    || .||:||||||.|.||||:|
Zfish    19 YATIVILKMMLMSLMTSYLRLTKQVFSNLEDTAMAIAEDKKKLVR-TDPDVERVRRCHLNDLESI 82

  Fly    94 LPFLLMSLAYVASGPNPLTARLLIRIGASARLIHTVVYAIIPVPQPARALAFFTTFAITCFEAGY 158
            :||:::.|.|..:||...||.|..|:...:|.||||.| |:.:|||.|.:||......|...|..
Zfish    83 VPFVVIGLLYALTGPVLSTALLHFRVFVVSRFIHTVAY-IMALPQPTRGVAFGVGLLTTLSMAYR 146

  Fly   159 VLVCCI 164
            ||...:
Zfish   147 VLTTAL 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33177NP_788903.1 MAPEG 30..160 CDD:279468 52/130 (40%)
mgst1.1NP_001005957.1 MAPEG 16..148 CDD:279468 52/130 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580256
Domainoid 1 1.000 108 1.000 Domainoid score I6364
eggNOG 1 0.900 - - E1_2B1WH
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4774
OMA 1 1.010 - - QHG50114
OrthoDB 1 1.010 - - D1591261at2759
OrthoFinder 1 1.000 - - FOG0003387
OrthoInspector 1 1.000 - - mtm6396
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10689
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3015
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.