DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33177 and Mgstl

DIOPT Version :9

Sequence 1:NP_788903.1 Gene:CG33177 / 32438 FlyBaseID:FBgn0053177 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_524696.2 Gene:Mgstl / 44110 FlyBaseID:FBgn0025814 Length:152 Species:Drosophila melanogaster


Alignment Length:142 Identity:83/142 - (58%)
Similarity:101/142 - (71%) Gaps:1/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLSKSNPVMGCYMFWTSLLVLKMLVMSLLTARQRMKTKTYANPEDLRLSRSTEVRFGDPNVERVR 83
            |||.||||...:.||..:||:|||:||||||.||.||||:|||||| :|...:|:|.||||||||
  Fly     7 LLSLSNPVFKSFTFWVGVLVIKMLLMSLLTAIQRFKTKTFANPEDL-MSPKLKVKFDDPNVERVR 70

  Fly    84 RAHRNDLENILPFLLMSLAYVASGPNPLTARLLIRIGASARLIHTVVYAIIPVPQPARALAFFTT 148
            |||||||||||||..:.|.||.:.|....|..|.|....||::||:|||::.||||:||||||..
  Fly    71 RAHRNDLENILPFFAIGLLYVLTDPAAFLAINLFRAVGIARIVHTLVYAVVVVPQPSRALAFFVA 135

  Fly   149 FAITCFEAGYVL 160
            ...|.:.|..|:
  Fly   136 LGATVYMALQVI 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33177NP_788903.1 MAPEG 30..160 CDD:279468 75/129 (58%)
MgstlNP_524696.2 MAPEG 20..148 CDD:395893 76/129 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448351
Domainoid 1 1.000 108 1.000 Domainoid score I6364
eggNOG 1 0.900 - - E1_2B1WH
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4774
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D115176at33392
OrthoFinder 1 1.000 - - FOG0003387
OrthoInspector 1 1.000 - - mtm6396
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10689
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3015
109.900

Return to query results.
Submit another query.