DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33177 and mgst1.2

DIOPT Version :9

Sequence 1:NP_788903.1 Gene:CG33177 / 32438 FlyBaseID:FBgn0053177 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001002215.2 Gene:mgst1.2 / 431762 ZFINID:ZDB-GENE-040704-59 Length:152 Species:Danio rerio


Alignment Length:149 Identity:54/149 - (36%)
Similarity:88/149 - (59%) Gaps:6/149 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SNPVMGCYMFWTSLLVLKMLVMSLLTARQRMKTKTYANPEDLRLSRSTEVR----FGDPNVERVR 83
            ::.|...:..:.::::|||:.|:.||...|...|.::|.||..:|::.|.|    ..:|:|||||
Zfish     6 NSDVFLAFCTYATIVILKMMFMAPLTGYFRFTRKAFSNWEDTAMSKNPEARKKMLQTNPDVERVR 70

  Fly    84 RAHRNDLENILPFLLMSLAYVASGPNPLTARLLIRIGASARLIHTVVYAIIPVPQPARALAFFTT 148
            |.|.||||||:||:::.|.|..:||:..||.|..|:...:|.|||..| ::.:|||:|.|::...
Zfish    71 RCHLNDLENIIPFVVIGLLYALTGPDLSTALLHFRVFVGSRFIHTASY-VLALPQPSRGLSWVVG 134

  Fly   149 FAITCFEAGYVLVCCIKYI 167
            . ||.|...|.::....|:
Zfish   135 M-ITTFSMAYRVLTTALYL 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33177NP_788903.1 MAPEG 30..160 CDD:279468 52/133 (39%)
mgst1.2NP_001002215.2 MAPEG 15..146 CDD:279468 52/132 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580253
Domainoid 1 1.000 108 1.000 Domainoid score I6364
eggNOG 1 0.900 - - E1_2B1WH
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4774
OMA 1 1.010 - - QHG50114
OrthoDB 1 1.010 - - D1591261at2759
OrthoFinder 1 1.000 - - FOG0003387
OrthoInspector 1 1.000 - - mtm6396
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10689
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3015
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.