DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33177 and CG33178

DIOPT Version :10

Sequence 1:NP_788903.1 Gene:CG33177 / 32438 FlyBaseID:FBgn0053177 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001285263.1 Gene:CG33178 / 318913 FlyBaseID:FBgn0053178 Length:177 Species:Drosophila melanogaster


Alignment Length:161 Identity:79/161 - (49%)
Similarity:109/161 - (67%) Gaps:13/161 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLSKSNPVMGCYMFWTSLLVLKMLVMSLLTARQRMKTKTYA------------NPEDLRLSRSTE 71
            :.:..|||..||:||:::||:|||:||||||.||.:.|..|            |.||| ..::.|
  Fly    18 MFTLENPVFCCYLFWSTVLVVKMLLMSLLTAVQRFRYKLLAIVPLALRRRIFPNQEDL-FFKNLE 81

  Fly    72 VRFGDPNVERVRRAHRNDLENILPFLLMSLAYVASGPNPLTARLLIRIGASARLIHTVVYAIIPV 136
            |:|.||:|||||||||||:|||||:.:|||.|:::.||...|.:|.|:.:.||:|||:|||:.||
  Fly    82 VQFDDPHVERVRRAHRNDMENILPYFIMSLIYISTNPNADVACILFRVASVARIIHTLVYAVYPV 146

  Fly   137 PQPARALAFFTTFAITCFEAGYVLVCCIKYI 167
            |||:|.|||.|...||.:.|..|.:..:.:|
  Fly   147 PQPSRILAFATMLLITFYMAAVVALRTLSFI 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33177NP_788903.1 MAPEG 30..160 CDD:460074 73/141 (52%)
CG33178NP_001285263.1 MAPEG 29..171 CDD:460074 74/142 (52%)

Return to query results.
Submit another query.