DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33177 and Mgst1

DIOPT Version :9

Sequence 1:NP_788903.1 Gene:CG33177 / 32438 FlyBaseID:FBgn0053177 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_599176.1 Gene:Mgst1 / 171341 RGDID:70927 Length:155 Species:Rattus norvegicus


Alignment Length:140 Identity:59/140 - (42%)
Similarity:80/140 - (57%) Gaps:19/140 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 NPVMGCYMFWTSLLVLKMLVMSLLTARQRMKTKTYANPEDLRLSRSTEVRFG-----------DP 77
            |.|:..:..:.::::.||:.:|..||.||:..|.:|||||.       ..||           |.
  Rat    10 NEVLMAFTSYATIILAKMMFLSSATAFQRLTNKVFANPEDC-------AGFGKGENAKKFLRTDE 67

  Fly    78 NVERVRRAHRNDLENILPFLLMSLAYVASGPNPLTARLLIRIGASARLIHTVVYAIIPVPQPARA 142
            .||||||||.||||||:|||.:.|.|..|||:..||.:..||...||:.||:.| :.|:|||.|.
  Rat    68 KVERVRRAHLNDLENIVPFLGIGLLYSLSGPDLSTALIHFRIFVGARIYHTIAY-LTPLPQPNRG 131

  Fly   143 LAFFTTFAIT 152
            ||||..:.:|
  Rat   132 LAFFVGYGVT 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33177NP_788903.1 MAPEG 30..160 CDD:279468 57/134 (43%)
Mgst1NP_599176.1 MAPEG 19..150 CDD:395893 57/131 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340467
Domainoid 1 1.000 107 1.000 Domainoid score I6378
eggNOG 1 0.900 - - E1_2B1WH
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 115 1.000 Inparanoid score I4732
OMA 1 1.010 - - QHG50114
OrthoDB 1 1.010 - - D1591261at2759
OrthoFinder 1 1.000 - - FOG0003387
OrthoInspector 1 1.000 - - otm45130
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10689
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3015
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.870

Return to query results.
Submit another query.