DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lsd-2 and plin6

DIOPT Version :9

Sequence 1:NP_572996.1 Gene:Lsd-2 / 32437 FlyBaseID:FBgn0030608 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001103951.1 Gene:plin6 / 794783 ZFINID:ZDB-GENE-070410-23 Length:490 Species:Danio rerio


Alignment Length:205 Identity:51/205 - (24%)
Similarity:86/205 - (41%) Gaps:37/205 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LERIIKLPVVNAAWDKSQDVYGKVKGKNRVFEWALTAAEDCV----TRAVTTAAPFVTKLDRPIA 100
            |.|::|||:|::|..::..||..|||:..:..:....||..|    |.|:..|||.:..|...|.
Zfish    12 LNRVVKLPLVSSALQQASSVYTVVKGRYPLLGFVGGVAELSVRSASTAALQQAAPLLQNLQPEIE 76

  Fly   101 YVDQTLVKGIDKLEVKAPIIKDTPQEIYNQAK----SKVIDV---VQPHLERVVKFKAAGQQKAA 158
            .|:...:.|:|:||...||::....|:....|    |::.|.   :...|:|.|       .:..
Zfish    77 AVNTYAMVGLDQLEKYFPILQQPTDEVVANLKDAFFSRLDDAQSRLNDELDRAV-------DRWD 134

  Fly   159 SLKDLAWQKANEVLATQYGSLAVNGVDTTTALAERLLEYYFP-------------------KCES 204
            .|.|..|:...|...:..|.....|:|.....:|..:.||.|                   ...:
Zfish   135 RLIDQMWRLLAEAQGSGPGRAITAGLDELITQSEEAVAYYLPLPPTLRYEYERMVQSYEDEHLHN 199

  Fly   205 DVEEDNDDKQ 214
            |.:||:|:::
Zfish   200 DDDEDDDEEE 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lsd-2NP_572996.1 Perilipin 40..>287 CDD:281086 51/205 (25%)
plin6NP_001103951.1 Perilipin 10..>178 CDD:281086 47/172 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592596
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001967
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14024
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.