DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lsd-2 and Plin5

DIOPT Version :9

Sequence 1:NP_572996.1 Gene:Lsd-2 / 32437 FlyBaseID:FBgn0030608 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001070816.1 Gene:Plin5 / 66968 MGIID:1914218 Length:463 Species:Mus musculus


Alignment Length:325 Identity:69/325 - (21%)
Similarity:124/325 - (38%) Gaps:80/325 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AEQKHATGNGTTGN-GTAMNDVDQPKDAKDLLPHLESLERIIKLPVVNAAWDKSQDVYGKVKGKN 67
            |.....:|:.|..: |:::.::||.          ..:.|::.||:|.|........|...|.::
Mouse    11 APHSRMSGDQTAQDPGSSLGELDQQ----------NVVNRVVALPLVKATCTAVSSAYNSAKDRH 65

  Fly    68 RVFEWALTAAEDCVTRAVTTAA-----PFVTKLDRPIAYVDQTLVKGIDKLEVKAPIIKDTPQEI 127
            .:...|...||.||. :|||.|     |.:..|...:|.|:....:|:||||.|.|.::.....:
Mouse    66 PLLGSACRLAEHCVC-SVTTCALDHAQPLLEHLQPQLATVNDLACRGLDKLEEKLPFLQQPSDMV 129

  Fly   128 YNQAKSKVIDVVQPHLERVVKFKAAGQQKAASLKDLAWQKANEVLATQYGSLAVNGVDTTTALAE 192
            ...||    |.|...:..:|.....|::.:..|:....|..:.||..                :|
Mouse   130 VTSAK----DTVAKSVTGMVDLAQRGRRWSGELRRSMSQAMDMVLGK----------------SE 174

  Fly   193 RLLEYYFPKCESDVEEDNDDKQNAVVQNGKSSENDMPVPASEDPVLHTVQ----------TVGRL 247
            :|::.:.|..|:::         ||:           ...:|.|.:.||:          .:|.|
Mouse   175 KLVDRFLPMTEAEL---------AVL-----------AAEAEGPEVGTVEEQRQQQGYFVRLGSL 219

  Fly   248 SNKISRRVYRNVSRQIKQVQKGNINDYLSSLIAALKLHQYINFINSSMGTNVEQSGGSSSDACSP 312
            |.::....|.:...:::| .|....:.|:.|...|:|.|::            |.|.|.|....|
Mouse   220 SARLRHLAYEHSLGKLRQ-SKHRTQEMLAQLQETLELIQHM------------QRGASPSPTFHP 271

  Fly   313  312
            Mouse   272  271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lsd-2NP_572996.1 Perilipin 40..>287 CDD:281086 57/261 (22%)
Plin5NP_001070816.1 Essential for lipid droplet targeting 1..188 47/207 (23%)
Interaction with LIPE. /evidence=ECO:0000269|PubMed:19717842 1..123 33/122 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32 4/20 (20%)
Perilipin 31..383 CDD:281086 65/305 (21%)
Interaction with PNPLA2 and ABHD5 200..463 18/85 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 433..463
Necessary for mitochondria recruitment at the lipid droplet surface 444..463
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847358
Domainoid 1 1.000 57 1.000 Domainoid score I10809
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5419
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1437332at2759
OrthoFinder 1 1.000 - - FOG0001967
OrthoInspector 1 1.000 - - otm43339
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14024
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.000

Return to query results.
Submit another query.