DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lsd-2 and Plin4

DIOPT Version :9

Sequence 1:NP_572996.1 Gene:Lsd-2 / 32437 FlyBaseID:FBgn0030608 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_011244848.1 Gene:Plin4 / 57435 MGIID:1929709 Length:1649 Species:Mus musculus


Alignment Length:359 Identity:64/359 - (17%)
Similarity:107/359 - (29%) Gaps:97/359 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TGNGTTGNGTAMNDVDQPK----DAKD-LLPHLESLERIIKLPVVNAAWDKSQDVYGKVKGKNRV 69
            ||......|||...:|..|    ..|| :...|.....:.|               |..:|....
Mouse  1085 TGAMNVAKGTAQMGIDTSKTVLTGTKDTVCAGLTGAINVAK---------------GATQGGLDT 1134

  Fly    70 FEWALTAAEDCVTRAVTTAAPFVTKLDRPIAYVDQTLVKGIDKLEVKAPIIKDTPQEIYNQAKSK 134
            .:..|...:|.||..:|.|          |.........|:|..:......|||.......|.:.
Mouse  1135 TKSVLMGTKDTVTTGLTGA----------INVAKGAAQGGLDTTKSVLLGTKDTVTTGLTGAANV 1189

  Fly   135 VIDVVQPHLERVVKFKAAGQQKAASLKDLAWQKANEVLATQYGSLAV------NGVDTTTALAER 193
            ..:.||..|:              :.|::.....:.:.|...|::.|      .|:||:.|....
Mouse  1190 AKETVQMGLD--------------TSKNILMDTKDSICAGATGAITVVKGAAQGGLDTSNAALTG 1240

  Fly   194 LLEYYFPKCESDVEEDNDDKQNAVVQNGKSSENDMPVPASEDPVLHTVQTVGRLSNKISRRVYRN 258
            .:                |.....||....:...|.: ..:|.|...|.:...::..|.:..  :
Mouse  1241 TM----------------DTAKGTVQTSLDTSKHMLI-GMKDTVCAGVTSAMNMAKGIHKNT--D 1286

  Fly   259 VSRQIKQ---VQKGNINDYLSSLIAALKLHQYINFINSSMGTNVEQSGGSSSDACSP-------- 312
            .:|..:.   ...||        :|...:|..::.:.||:       .||.|..|..        
Mouse  1287 TTRDTQSSVLAHSGN--------VATNAIHTGVHTVPSSL-------SGSHSIICHEPSIYRATN 1336

  Fly   313 --FGTTTSTTTTTTTSSTSNNKPVVALPHVAKSK 344
              .|....|:|.:....||:......|.||.:.:
Mouse  1337 HGVGQAILTSTESLCCETSSFSDKYGLGHVTEPR 1370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lsd-2NP_572996.1 Perilipin 40..>287 CDD:281086 40/255 (16%)
Plin4XP_011244848.1 Perilipin <177..>255 CDD:367309
Perilipin <242..>288 CDD:367309
COG5412 309..834 CDD:333356
COG5412 804..1338 CDD:333356 56/325 (17%)
Perilipin <1373..1630 CDD:367309
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847356
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.