DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lsd-2 and PLIN1

DIOPT Version :9

Sequence 1:NP_572996.1 Gene:Lsd-2 / 32437 FlyBaseID:FBgn0030608 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001138783.1 Gene:PLIN1 / 5346 HGNCID:9076 Length:522 Species:Homo sapiens


Alignment Length:256 Identity:63/256 - (24%)
Similarity:104/256 - (40%) Gaps:50/256 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LPHLES-LERIIKLPVVNAAWDKSQDVYGKVKGKNRVFEWALTAAEDCVTRAVTTAA----PFVT 93
            ||..|: |:|:::||||:...:..|..|...|..:.:......|.|..|..|.:.||    |.|.
Human    14 LPEQENVLQRVLQLPVVSGTCECFQKTYTSTKEAHPLVASVCNAYEKGVQSASSLAAWSMEPVVR 78

  Fly    94 KLDRPIAYVDQTLVKGIDKLEVKAPIIKDTPQEIYNQAKSKVIDVVQPHL--------------- 143
            :|.......::...:|:|.||.|.|.::..|::|.::.|    |.:...|               
Human    79 RLSTQFTAANELACRGLDHLEEKIPALQYPPEKIASELK----DTISTRLRSARNSISVPIASTS 139

  Fly   144 ERVVKFKAAGQQKAASLKDLAWQKANEVLA----TQYGSLAVNGVDTTTALAERLLEYYFPKCES 204
            ::|:....||       .:|||..|.:...    |:.|.||..|.|......|:::||..|    
Human   140 DKVLGAALAG-------CELAWGVARDTAEFAANTRAGRLASGGADLALGSIEKVVEYLLP---- 193

  Fly   205 DVEEDNDDKQNAVVQNGKSSENDMPVPASEDPVLHTVQTVGRLSNKISRRVYRNVSRQIKQ 265
                  .||:.:....|.......|   ...|.|  :..||.|:|.:||...:.::|.::|
Human   194 ------PDKEESAPAPGHQQAQKSP---KAKPSL--LSRVGALTNTLSRYTVQTMARALEQ 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lsd-2NP_572996.1 Perilipin 40..>287 CDD:281086 60/249 (24%)
PLIN1NP_001138783.1 Perilipin 14..389 CDD:281086 63/256 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..217 4/24 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..318
Required for interaction with CIDEC. /evidence=ECO:0000250 291..319
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 413..522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156954
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I5366
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1437332at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto91736
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4632
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.