DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lsd-2 and PLIN5

DIOPT Version :9

Sequence 1:NP_572996.1 Gene:Lsd-2 / 32437 FlyBaseID:FBgn0030608 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001013728.2 Gene:PLIN5 / 440503 HGNCID:33196 Length:463 Species:Homo sapiens


Alignment Length:263 Identity:60/263 - (22%)
Similarity:102/263 - (38%) Gaps:63/263 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LERIIKLPVVNAAWDKSQDVYGKVKGKNRVFEWALTAAEDCV----TRAVTTAAPFVTKLDRPIA 100
            ::|::.||:|.|......|||...|.::.:...|...||:||    |||:..|.|.:..|...:|
Human    23 VQRVVALPLVRATCTAVCDVYSAAKDRHPLLGSACRLAENCVCGLTTRALDHAQPLLEHLQPQLA 87

  Fly   101 YVDQTLVKGIDKLEVKAPIIKDTPQEIYNQAKSKVIDVVQPHLERVVKFKAAGQQKAASLKDLAW 165
            .::....:|:||||.|.|.::...:.:...||    |||...:..||.....|::.:..||    
Human    88 TMNSLACRGLDKLEEKLPFLQQPSETVVTSAK----DVVASSVTGVVDLARRGRRWSVELK---- 144

  Fly   166 QKANEVLATQYGSLAVNGVDTTTALAERLLEYYFPKCESDVE--------------EDNDDKQNA 216
                        ....:.||.....:|.|::::.|..|.::.              ||...:|..
Human   145 ------------RSVSHAVDVVLEKSEELVDHFLPMTEEELAALAAEAEGPEVGSVEDQRRQQGY 197

  Fly   217 VVQNGKSSENDMPVPASEDPVLHTVQTVGRLSNKISRRVYRNVSRQIKQVQKGNINDYLSSLIAA 281
            .|:                        :|.||.:|....|.:...:::| .|....|.|:.|...
Human   198 FVR------------------------LGSLSARIRHLAYEHSVGKLRQ-SKHRAQDTLAQLQET 237

  Fly   282 LKL 284
            |:|
Human   238 LEL 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lsd-2NP_572996.1 Perilipin 40..>287 CDD:281086 60/263 (23%)
PLIN5NP_001013728.2 Essential for lipid droplet targeting. /evidence=ECO:0000250 1..173 44/169 (26%)
Interaction with LIPE. /evidence=ECO:0000250 1..108 28/84 (33%)
Perilipin 16..368 CDD:281086 60/263 (23%)
Interaction with PNPLA2 and ABHD5. /evidence=ECO:0000250 185..463 16/81 (20%)
Recruits mitochondria at the lipid droplet surface. /evidence=ECO:0000250 444..463
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156951
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1437332at2759
OrthoFinder 1 1.000 - - FOG0001967
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14024
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.