DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lsd-2 and plin3

DIOPT Version :9

Sequence 1:NP_572996.1 Gene:Lsd-2 / 32437 FlyBaseID:FBgn0030608 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001373243.1 Gene:plin3 / 335278 ZFINID:ZDB-GENE-030131-7218 Length:416 Species:Danio rerio


Alignment Length:274 Identity:58/274 - (21%)
Similarity:106/274 - (38%) Gaps:54/274 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KDAKDLLPHLESLERIIKLPVVNAAWDKSQDVYGKVKGKNRVFEWALTAAEDCV----TRAVTTA 88
            ||.:|.......:.|:..||:|::|.....:.|...|....:.:..:..||..|    ..|.|.:
Zfish    10 KDKEDSQEQQSVISRVGNLPLVSSACGAVYNAYSSTKDSVPLLKGVMEVAESGVRTLGAAASTGS 74

  Fly    89 APFVTKLDRPIAYVDQTLVKGIDKLEVKAPI--------IKDTPQEIYNQ---AKSKVIDVVQPH 142
            .|.:.:|:..||.|::..:||::|:|...||        :.||...:|..   ||..|:..|...
Zfish    75 KPILDRLEPQIAAVNEYAIKGLEKVEGNLPILQQPADKLVSDTVGMVYQSVTGAKDAVVGAVMEG 139

  Fly   143 LERVVKFKAAGQQKAASLKDLAWQKANEVLATQYGSLAVNGVDTTTALAERLLEYYFPKCESDVE 207
            :|:.......|              .|.|:.::.|.:..||||.....:|..:|...|..|    
Zfish   140 VEKTRMAVTGG--------------INTVMGSRVGQMVSNGVDKALTHSEDWVEQNLPISE---- 186

  Fly   208 EDNDDKQNAVVQNGKSSENDMPVPASEDPVLHTVQT-----VGRLSNKISRRVYRNV---SRQIK 264
                 |:.|.:..        |.|..|:..:.:.::     :|:||.|:..|.....   :|:.:
Zfish   187 -----KELATLAE--------PRPGEEEGFIVSTRSSYFVRLGKLSAKVRERALEQSLLRARKAR 238

  Fly   265 QVQKGNINDYLSSL 278
            .....::....|::
Zfish   239 DTTHASVTQMTSTM 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lsd-2NP_572996.1 Perilipin 40..>287 CDD:281086 55/262 (21%)
plin3NP_001373243.1 Perilipin 14..411 CDD:397257 56/270 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592595
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1437332at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4632
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.