DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lsd-2 and Plin2

DIOPT Version :9

Sequence 1:NP_572996.1 Gene:Lsd-2 / 32437 FlyBaseID:FBgn0030608 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001007145.1 Gene:Plin2 / 298199 RGDID:728889 Length:422 Species:Rattus norvegicus


Alignment Length:300 Identity:71/300 - (23%)
Similarity:114/300 - (38%) Gaps:53/300 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PHLESLERIIKLPVVNAAWDKSQDVYGKVKGKN----RVFEWALTAAEDCVTRAVTTAAPFVTKL 95
            |....:.|:..||:|::.:|.....|...|.::    .|.|.|........:.|||.|.|.:.||
  Rat     8 PQPSVVTRVANLPLVSSTYDLVSSAYVSTKDQHPYLRSVCEMAEKGVRTVTSVAVTGALPIIQKL 72

  Fly    96 DRPIAYVDQTLVKGIDKLEVKAPIIKDTPQEIYNQAKSKVI--------------DVVQPHLERV 146
            :..||..:....||:|::|.:.||:.....||...|:..|.              |.|...:..|
  Rat    73 EPQIAVANTYACKGLDRMEARLPILNQPTSEIVANARGAVTGAKDVVTTTMAGAKDSVASTVSGV 137

  Fly   147 V-KFKAAGQQKAASLKDLAWQKANEVLATQYG--SLAVNGVDTTTALAERLLEYYFPKCESDVEE 208
            | |.|.|........|.:    .|..:.|..|  .|..:||:...:.:|.|::.|.|..:.::|.
  Rat   138 VDKTKGAVTGSVERTKSV----VNGGIDTVLGMVQLMSSGVENAISKSELLVDQYLPLTQKELEM 198

  Fly   209 DNDDKQN-AVVQNGKSSENDMPVPASEDPVLHTVQTVGRLSNKISRRVYRNVSRQIKQV-QKGNI 271
            :....:. .:||..:..|.                 :..||.||..|.|.....:||.. |||  
  Rat   199 EAKKVEGFDMVQKQRYYER-----------------LESLSTKICTRAYHQALGRIKDAKQKG-- 244

  Fly   272 NDYLSSLIAALKLHQYINFINSSMGTNVEQSGGSSSDACS 311
            .:.:|      :||..::.|..:. .||..:.....|..|
  Rat   245 QETIS------QLHSTVHLIEFAR-KNVHSANQKIQDKLS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lsd-2NP_572996.1 Perilipin 40..>287 CDD:281086 65/269 (24%)
Plin2NP_001007145.1 Perilipin 5..404 CDD:397257 70/299 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350910
Domainoid 1 1.000 61 1.000 Domainoid score I10186
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I5350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1437332at2759
OrthoFinder 1 1.000 - - FOG0001967
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14024
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.000

Return to query results.
Submit another query.