DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lsd-2 and Plin1

DIOPT Version :9

Sequence 1:NP_572996.1 Gene:Lsd-2 / 32437 FlyBaseID:FBgn0030608 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001295074.1 Gene:Plin1 / 25629 RGDID:3351 Length:518 Species:Rattus norvegicus


Alignment Length:249 Identity:63/249 - (25%)
Similarity:108/249 - (43%) Gaps:36/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LPHLES-LERIIKLPVVNAAWDKSQDVYGKVKGKNRVFEWALTAAEDCVTRAVTTAA----PFVT 93
            ||..|: |:|:::||||:...:..|..|...|..:.:......|.|..|..|...||    |.|.
  Rat    14 LPEQENVLQRVLQLPVVSGTCECFQKTYNSTKEAHPLVASVCNAYEKGVQGASNLAAWSMEPVVR 78

  Fly    94 KLDRPIAYVDQTLVKGIDKLEVKAPIIKDTPQEIYNQAKSKV----------IDV-VQPHLERVV 147
            :|.......::...:|:|.||.|.|.::..|::|.::.|..:          |.| :....::|:
  Rat    79 RLSTQFTAANELACRGLDHLEEKIPALQYPPEKIASELKGTISTRLRSARNSISVPIASTSDKVL 143

  Fly   148 KFKAAGQQKAASL-KDLAWQKANEVLATQYGSLAVNGVDTTTALAERLLEYYFPKCESDVEEDND 211
            ....||.:.|..: |:.|...||    |:.|.||..|.|......|:::||..|          .
  Rat   144 GATLAGCELALGMAKETAEYAAN----TRVGRLASGGADLALGSIEKVVEYLLP----------P 194

  Fly   212 DKQNAVVQNGKSSENDMPVPASEDPVLHTVQTVGRLSNKISRRVYRNVSRQIKQ 265
            ||..:...:|:  :.....|.::..:|..|.|   |:|.:||...:..:|.:|:
  Rat   195 DKVESAPSSGR--QKMQKAPKAKPSLLRRVST---LANTLSRHTMQTTARALKR 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lsd-2NP_572996.1 Perilipin 40..>287 CDD:281086 60/242 (25%)
Plin1NP_001295074.1 Perilipin 14..392 CDD:281086 63/249 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..217 2/21 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 285..321
Required for interaction with CIDEC. /evidence=ECO:0000250 291..322
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350911
Domainoid 1 1.000 61 1.000 Domainoid score I10186
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I5350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1437332at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto98801
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.