DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lsd-2 and Plin1

DIOPT Version :9

Sequence 1:NP_572996.1 Gene:Lsd-2 / 32437 FlyBaseID:FBgn0030608 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001106942.1 Gene:Plin1 / 103968 MGIID:1890505 Length:517 Species:Mus musculus


Alignment Length:249 Identity:64/249 - (25%)
Similarity:107/249 - (42%) Gaps:37/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LPHLES-LERIIKLPVVNAAWDKSQDVYGKVKGKNRVFEWALTAAEDCVTRAVTTAA----PFVT 93
            ||..|: |:|:::||||:...:..|..|...|..:.:......|.|..|..|...||    |.|.
Mouse    14 LPEQENVLQRVLQLPVVSGTCECFQKTYNSTKEAHPLVASVCNAYEKGVQGASNLAAWSMEPVVR 78

  Fly    94 KLDRPIAYVDQTLVKGIDKLEVKAPIIKDTPQEIYNQAKSKV----------IDV-VQPHLERVV 147
            :|.......::...:|:|.||.|.|.::..|::|.::.|..:          |.| :....::|:
Mouse    79 RLSTQFTAANELACRGLDHLEEKIPALQYPPEKIASELKGTISTRLRSARNSISVPIASTSDKVL 143

  Fly   148 KFKAAGQQKAASL-KDLAWQKANEVLATQYGSLAVNGVDTTTALAERLLEYYFPKCESDVEEDND 211
            ....||.:.|..: |:.|...||    |:.|.||..|.|......|:::|:..|          .
Mouse   144 GATLAGCELALGMAKETAEYAAN----TRVGRLASGGADLALGSIEKVVEFLLP----------P 194

  Fly   212 DKQNAVVQNGKSSENDMPVPASEDPVLHTVQTVGRLSNKISRRVYRNVSRQIKQ 265
            ||::| ..:|:......|   ...|.|  |:.|..|:|.:||...:..:..:||
Mouse   195 DKESA-PSSGRQRTQKAP---KAKPSL--VRRVSTLANTLSRHTMQTTAWALKQ 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lsd-2NP_572996.1 Perilipin 40..>287 CDD:281086 61/242 (25%)
Plin1NP_001106942.1 Perilipin 14..391 CDD:367309 64/249 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 195..216 5/24 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 286..320
Required for interaction with CIDEC. /evidence=ECO:0000269|PubMed:23481402 290..321
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 425..490
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847359
Domainoid 1 1.000 57 1.000 Domainoid score I10809
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5419
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1437332at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44307
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4632
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.