DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lsd-2 and PLIN3

DIOPT Version :9

Sequence 1:NP_572996.1 Gene:Lsd-2 / 32437 FlyBaseID:FBgn0030608 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_005808.3 Gene:PLIN3 / 10226 HGNCID:16893 Length:434 Species:Homo sapiens


Alignment Length:306 Identity:61/306 - (19%)
Similarity:125/306 - (40%) Gaps:48/306 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TGNGTTGNGTAMNDVDQPKDAKDLLPHLESLERIIKLPVVNAAWDKSQDVYGKVKGKNRVFEWAL 74
            :.:|...:|:....|::|.....:      ::|:..:|::::..|.....|...|......:...
Human     2 SADGAEADGSTQVTVEEPVQQPSV------VDRVASMPLISSTCDMVSAAYASTKESYPHIKTVC 60

  Fly    75 TAAEDCV----TRAVTTAAPFVTKLDRPIAYVDQTLVKGIDKLEVKAPIIKDTPQEIYNQAK--- 132
            .|||..|    ..||:.|.|.::||:..||...:...:|:||||...||::...:::....|   
Human    61 DAAEKGVRTLTAAAVSGAQPILSKLEPQIASASEYAHRGLDKLEENLPILQQPTEKVLADTKELV 125

  Fly   133 -SKVI----------DVVQPHL-ERVVKFKAAGQQKAASLKDLAWQKANEVLATQYGSLAVNGVD 185
             |||.          |.|...| |.|...:.|.|......|.:.......|:.::.|.:.::|||
Human   126 SSKVSGAQEMVSSAKDTVATQLSEAVDATRGAVQSGVDKTKSVVTGGVQSVMGSRLGQMVLSGVD 190

  Fly   186 TTTALAERLLEYYFPKCESD---VEEDNDDKQNAVVQNGKSSENDMPVPASEDPVLHTVQTVGRL 247
            |....:|...:.:.|..:::   :....|....|.||..:..::            :.|: :|.|
Human   191 TVLGKSEEWADNHLPLTDAELARIATSLDGFDVASVQQQRQEQS------------YFVR-LGSL 242

  Fly   248 SNKISRRVYRNVSRQIKQVQKGNINDYLSSLIAALKLHQYINFINS 293
            |.::.:..|.:...:::..::       .:..|.|:|.|.::.:.:
Human   243 SERLRQHAYEHSLGKLRATKQ-------RAQEALLQLSQVLSLMET 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lsd-2NP_572996.1 Perilipin 40..>287 CDD:281086 56/268 (21%)
PLIN3NP_005808.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 4/19 (21%)
Perilipin 19..411 CDD:281086 58/289 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156955
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1437332at2759
OrthoFinder 1 1.000 - - FOG0001967
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14024
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4632
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.980

Return to query results.
Submit another query.