DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lsd-2 and plin3

DIOPT Version :9

Sequence 1:NP_572996.1 Gene:Lsd-2 / 32437 FlyBaseID:FBgn0030608 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_002934059.2 Gene:plin3 / 100487248 XenbaseID:XB-GENE-962693 Length:419 Species:Xenopus tropicalis


Alignment Length:291 Identity:67/291 - (23%)
Similarity:126/291 - (43%) Gaps:44/291 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 NGTA--MNDVDQPKDAKDLLPHLESLERIIKLPVVNAAWDKSQDVYGKVKGKN----RVFEWALT 75
            ||.|  .::|.:.::|         :.|:..||:|::|......||...|..:    .|.:.|..
 Frog     4 NGAAPIADEVPEQQNA---------VSRVTSLPLVSSACSVVGAVYSSTKESHPYIRSVCDVAEK 59

  Fly    76 AAEDCVTRAVTTAAPFVTKLDRPIAYVDQTLVKGIDKLEVKAPIIKDTPQEIYNQAKSKVI---- 136
            .|:.....|::.|.|.:|:|:..||..::.:.||:||||...||::...:::.:..|..|.    
 Frog    60 GAKTLTEAAMSGAQPLLTRLEPQIASANELVCKGLDKLESTLPILQQPTEKVVSDTKDLVTNTVT 124

  Fly   137 ---DVVQPHLERVVKFKAAGQQKAASLKDLAWQKANEVLATQYGSLAVNGVDTTTALAERLLEYY 198
               |.|...:..|:.......|.:..:..:|   .:.|:.|:.|.|..|.|||....:|.|:::|
 Frog   125 GARDTVTGAVSGVMGLAYGAMQGSVDMTRVA---VSSVMGTRVGQLVTNSVDTVLGKSEELVDHY 186

  Fly   199 FPKCESDVEEDNDDKQNAVVQNGKSSENDMPVPASEDPVLHT-VQTVGRLSNKISRRVYRNVSRQ 262
            .|..:.:           :.|...|.|.....|..|.....: ...:|.||.::..|.|::...:
 Frog   187 LPMTDEE-----------LAQLASSVEGFEVAPLQEQRKQQSYFVRLGSLSTRLRHRAYQHSLGK 240

  Fly   263 IKQVQKGNINDYLSSLIAALKLHQYINFINS 293
            ::.. :.|..:.|:      :|||.|:.::|
 Frog   241 VRSA-RNNTQELLT------QLHQTIDLMDS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lsd-2NP_572996.1 Perilipin 40..>287 CDD:281086 59/258 (23%)
plin3XP_002934059.2 Perilipin 13..391 CDD:367309 64/282 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I9353
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I5145
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1437332at2759
OrthoFinder 1 1.000 - - FOG0001967
OrthoInspector 1 1.000 - - mtm9506
Panther 1 1.100 - - O PTHR14024
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4632
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.100

Return to query results.
Submit another query.