DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lsd-2 and plin1

DIOPT Version :9

Sequence 1:NP_572996.1 Gene:Lsd-2 / 32437 FlyBaseID:FBgn0030608 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_021323484.1 Gene:plin1 / 100034463 ZFINID:ZDB-GENE-050419-213 Length:467 Species:Danio rerio


Alignment Length:304 Identity:63/304 - (20%)
Similarity:113/304 - (37%) Gaps:68/304 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QPKDAKDLLPHLESLERIIKLPVVNAAWDKSQDVYGKVKGKNRVFEWALTAAEDCVTR----AVT 86
            :.||..::|.......||:.:..||||.:..:..|...|..:.:........|..|:|    ||.
Zfish     4 EKKDTGEVLKDQNVFFRILNIRSVNAALESIEKTYTSTKQSHPIISSVCGLYEKGVSRAGNLAVW 68

  Fly    87 TAAPFVTKLDRPIAYVDQTLVKGIDKLEVKAPIIKDTPQEIYNQAKSKVIDVVQ----------P 141
            :..|.:..|...:...:....||:|:||.|.|.::..|.|:....|..:...::          .
Zfish    69 SMKPALHVLQPQLVAANSMACKGLDRLEEKVPALQSPPAELAANIKGLMSSTLEAAKDGITCPIK 133

  Fly   142 HLERVV--KFKAAGQQKAASLKD------------LAWQKANEVLATQYGSLAVNGVDTTTALAE 192
            |...||  |..:..||...:|..            ||.|:|:..|                :|.|
Zfish   134 HSSNVVLDKVSSRYQQSKNTLSGGIQYILNSKLVFLAEQRASRAL----------------SLTE 182

  Fly   193 RLLEYYFPKCESDVEED--NDDKQNAVVQNGKSSENDMPVPASEDPVLHTVQTVGRLSNKISRRV 255
            .|::...|......|.|  .:::|.:.|    .:.:.||:          ...:|.|::.|.||.
Zfish   183 NLIDCILPGTSDKTENDRSTEEQQESYV----GASDPMPI----------FSRLGALASTICRRA 233

  Fly   256 YRNVSRQIK-QVQKGNINDYLSSLIAALK-LHQYINFINSSMGT 297
            :.....|:: ...:|:      :|:..:. |:..:.|..|:|.|
Zfish   234 FEKTFAQLQLSTHQGH------TLVKRIPGLNPLVEFTMSTMRT 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lsd-2NP_572996.1 Perilipin 40..>287 CDD:281086 56/278 (20%)
plin1XP_021323484.1 Perilipin 15..332 CDD:308593 60/293 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592598
Domainoid 1 1.000 65 1.000 Domainoid score I10024
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I5363
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1437332at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14024
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.