DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dob and Pnpla5

DIOPT Version :9

Sequence 1:NP_572995.1 Gene:dob / 32436 FlyBaseID:FBgn0030607 Length:480 Species:Drosophila melanogaster
Sequence 2:XP_036015516.1 Gene:Pnpla5 / 75772 MGIID:1923022 Length:433 Species:Mus musculus


Alignment Length:251 Identity:102/251 - (40%)
Similarity:159/251 - (63%) Gaps:5/251 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SLSFSGCGFLGIYHVGVAVCLRQHAPQLL--LERIAGASAGALAACCLICDLPLECMAGDFLRVV 70
            :|||||.|::|:|||||..||||.||:|:  ..|..|:|:|||.|..::.....:....:.|.:|
Mouse    11 NLSFSGSGYMGLYHVGVTQCLRQRAPRLIQGARRFYGSSSGALNAMAIVFGKSADFACSNLLDLV 75

  Fly    71 QEIQRHSLGAFSPWFNLPECLLEGMRSWLPEDAHLLASGRLHISLTRVSDRRNVVMSEFSSRQEL 135
            :.::|.|||.|.|.:...|.:.:.:...||::.|:|||.||.||:||..|.:|.::::|::|.|.
Mouse    76 KLVERLSLGIFHPAYGPAEHIRKKLYENLPDNCHILASQRLGISMTRWPDGKNFIVTDFATRDEF 140

  Fly   136 LQALMCSCFIPGLSGLVPPQVRGVRYMDGAFSDNLPLLD-EHTVTVSPFCGESDICPRDQNPHLL 199
            :|||:|:.::|...|::||..||.|::|||.|:|||..| ..|:|||||.|..||||::.:..|.
Mouse   141 IQALICTLYLPLYCGVIPPAFRGQRFIDGALSNNLPFSDCPTTITVSPFNGTVDICPQNISHSLF 205

  Fly   200 QLNINWANTCIRLSRRNLRRMVRILVPGRADFMANFCQQGYDDTLQFLRRNSLLNE 255
            :|..  .|...::|.||..|.::.:.|.:.:.:|:.|:|||.|.|:||.|..|..|
Mouse   206 ELTA--FNASFQISTRNFFRGLKSVFPPKPEVVADHCRQGYLDALRFLERRGLTKE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dobNP_572995.1 Pat_iPLA2 7..253 CDD:132857 100/247 (40%)
EIN3 <270..>375 CDD:296674
Pnpla5XP_036015516.1 Pat_PNPLA5-mammals 1..403 CDD:132862 102/251 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1204225at2759
OrthoFinder 1 1.000 - - FOG0000670
OrthoInspector 1 1.000 - - mtm8728
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12406
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.