DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dob and PNPLA2

DIOPT Version :9

Sequence 1:NP_572995.1 Gene:dob / 32436 FlyBaseID:FBgn0030607 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_065109.1 Gene:PNPLA2 / 57104 HGNCID:30802 Length:504 Species:Homo sapiens


Alignment Length:250 Identity:124/250 - (49%)
Similarity:169/250 - (67%) Gaps:5/250 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SLSFSGCGFLGIYHVGVAVCLRQHAPQLLLE--RIAGASAGALAACCLICDLPLECMAGDFLRVV 70
            ::||:||||||:|:||||.|||:|||.|:..  .|.|||||||.|..|:..:.|......|:.|.
Human     9 NISFAGCGFLGVYYVGVASCLREHAPFLVANATHIYGASAGALTATALVTGVCLGEAGAKFIEVS 73

  Fly    71 QEIQRHSLGAFSPWFNLPECLLEGMRSWLPEDAHLLASGRLHISLTRVSDRRNVVMSEFSSRQEL 135
            :|.::..||...|.|||.:.:...:...||.|:|..|||||.||||||||..||::|.|:|:.||
Human    74 KEARKRFLGPLHPSFNLVKIIRSFLLKVLPADSHEHASGRLGISLTRVSDGENVIISHFNSKDEL 138

  Fly   136 LQALMCSCFIPGLSGLVPPQVRGVRYMDGAFSDNLPLLD-EHTVTVSPFCGESDICPRDQNPHLL 199
            :||.:||.|||...||:||.::||||:||..||||||.: ::|:|||||.|||||||:|.:.::.
Human   139 IQANVCSGFIPVYCGLIPPSLQGVRYVDGGISDNLPLYELKNTITVSPFSGESDICPQDSSTNIH 203

  Fly   200 QLNINWANTCIRLSRRNLRRMVRILVPGRADFMANFCQQGYDDTLQFLRRNSLLN 254
            :|.:  .||.|:.:.|||.|:.:.|.|.....:...|:|||.|.|:||:||.|||
Human   204 ELRV--TNTSIQFNLRNLYRLSKALFPPEPLVLREMCKQGYRDGLRFLQRNGLLN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dobNP_572995.1 Pat_iPLA2 7..253 CDD:132857 121/247 (49%)
EIN3 <270..>375 CDD:296674
PNPLA2NP_065109.1 Pat_PNPLA2 4..252 CDD:132859 119/244 (49%)
GXGXXG. /evidence=ECO:0000255|PROSITE-ProRule:PRU01161 14..19 4/4 (100%)
GXSXG. /evidence=ECO:0000255|PROSITE-ProRule:PRU01161 45..49 3/3 (100%)
DGA/G. /evidence=ECO:0000255|PROSITE-ProRule:PRU01161 166..168 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 463..492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 230 1.000 Inparanoid score I3444
Isobase 1 0.950 - 0 Normalized mean entropy S5329
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1204225at2759
OrthoFinder 1 1.000 - - FOG0000670
OrthoInspector 1 1.000 - - mtm8494
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12406
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1585
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.