DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dob and Pnpla4

DIOPT Version :9

Sequence 1:NP_572995.1 Gene:dob / 32436 FlyBaseID:FBgn0030607 Length:480 Species:Drosophila melanogaster
Sequence 2:XP_006257029.1 Gene:Pnpla4 / 363471 RGDID:1562200 Length:259 Species:Rattus norvegicus


Alignment Length:253 Identity:92/253 - (36%)
Similarity:132/253 - (52%) Gaps:23/253 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LSFSGCGFLGIYHVGVAVCLRQHAPQLL--LERIAGASAGALAACCLICDLP--LECMAGDFLRV 69
            ||||.||||||||:|.|..|.:....||  :...||||||||.| .|:...|  :|.........
  Rat    13 LSFSSCGFLGIYHLGAATVLSKRGRGLLCNVTGFAGASAGALVA-TLLLTAPERIEACTRFTFAF 76

  Fly    70 VQEIQRHSLGAFSPWFNLPECLLEGMRSWLPEDAHLLASGRLHISLTRVSDRRNVVMSEFSSRQE 134
            .:|::..:||..:|.::....|..|:...||:.||.||..|||:|:|.... :|.::|.|:.|..
  Rat    77 AEEVRMQALGPLTPGYDFMARLRGGIDEILPQHAHELARERLHVSVTSAVG-QNYLVSNFTCRDN 140

  Fly   135 LLQALMCSCFIPGLSGLVPPQVRGVRYMDGAFSDNLPLLDE-HTVTVSPFCGESDICPRDQNPHL 198
            |:..|:.|||||..:||.|....|...:||..:::||:|.. .|||.|||.|.:|:.|||     
  Rat   141 LITVLLASCFIPFYAGLKPMDCAGQLCVDGGLTNSLPVLPTGRTVTFSPFSGRADVSPRD----- 200

  Fly   199 LQLNINWANTCIRLSRR-------NLRRMVRILVPGRADFMANFCQQGYDDTLQFLRR 249
                :.|....:|::::       ||.|:.:.|.|.....|......|..||::||||
  Rat   201 ----LGWPGIYVRVAKQDVMVSMANLVRVQQALFPPSRGMMEAIYGMGMTDTVRFLRR 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dobNP_572995.1 Pat_iPLA2 7..253 CDD:132857 92/253 (36%)
EIN3 <270..>375 CDD:296674
Pnpla4XP_006257029.1 Pat_PNPLA4 12..256 CDD:132861 92/253 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1204225at2759
OrthoFinder 1 1.000 - - FOG0000670
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.