DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dob and Pnpla3

DIOPT Version :9

Sequence 1:NP_572995.1 Gene:dob / 32436 FlyBaseID:FBgn0030607 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_001269253.1 Gene:Pnpla3 / 362972 RGDID:1595843 Length:425 Species:Rattus norvegicus


Alignment Length:252 Identity:117/252 - (46%)
Similarity:166/252 - (65%) Gaps:5/252 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RRSLSFSGCGFLGIYHVGVAVCLRQHAPQLLLE--RIAGASAGALAACCLICDLPLECMAGDFLR 68
            |.||||:||||||.||:|..:||.:.||.:|.|  ...|.|||||.|...:|.|||:.:....:.
  Rat     7 RWSLSFAGCGFLGFYHIGATLCLSERAPHILREARTFFGCSAGALHAVTFVCSLPLDHIMEILMD 71

  Fly    69 VVQEIQRHSLGAFSPWFNLPECLLEGMRSWLPEDAHLLASGRLHISLTRVSDRRNVVMSEFSSRQ 133
            :|::.:..::|...|:||:.:|:.:|::..||::.|.:.||:::||||||||..||::|||.|:.
  Rat    72 LVRKARSRNIGTLHPFFNINKCVRDGLQETLPDNVHQIISGKVYISLTRVSDGENVLVSEFHSKD 136

  Fly   134 ELLQALMCSCFIPGLSGLVPPQVRGVRYMDGAFSDNLPLLD-EHTVTVSPFCGESDICPRDQNPH 197
            |::.||:||||||..|||:||..||.||:||..|||:|:|| :.|:|||||.||.||||:.::.:
  Rat   137 EVVDALVCSCFIPLFSGLIPPSFRGERYVDGGVSDNVPVLDAKTTITVSPFYGEHDICPKVKSTN 201

  Fly   198 LLQLNINWANTCIRLSRRNLRRMVRILVPGRADFMANFCQQGYDDTLQFLRRNSLLN 254
            .||:||  .|..:||...||..:.|.|.|.....|...|.|||.|..:||..|.:.|
  Rat   202 FLQVNI--TNLSLRLCTGNLHLLTRALFPSDVKVMGELCFQGYLDAFRFLEENGICN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dobNP_572995.1 Pat_iPLA2 7..253 CDD:132857 115/248 (46%)
EIN3 <270..>375 CDD:296674
Pnpla3NP_001269253.1 Patatin_and_cPLA2 8..259 CDD:299702 116/251 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 261 1.000 Inparanoid score I3023
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1204225at2759
OrthoFinder 1 1.000 - - FOG0000670
OrthoInspector 1 1.000 - - mtm8965
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12406
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1585
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.930

Return to query results.
Submit another query.