DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dob and D1054.1

DIOPT Version :9

Sequence 1:NP_572995.1 Gene:dob / 32436 FlyBaseID:FBgn0030607 Length:480 Species:Drosophila melanogaster
Sequence 2:NP_505749.3 Gene:D1054.1 / 179492 WormBaseID:WBGene00008370 Length:266 Species:Caenorhabditis elegans


Alignment Length:271 Identity:92/271 - (33%)
Similarity:135/271 - (49%) Gaps:27/271 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKIRT-------------RRSLSFSGCGFLGIYHVGVAVCLRQHAPQL--LLERIAGASAGALAA 50
            |||.|             :.:|||||.||||.|:.|.|..|.|....:  .::|.||||||:|.|
 Worm     1 MKISTILLKRLNKLEDVSKLALSFSGSGFLGAYNFGAAKRLMQEKKTIGEKVDRFAGASAGSLVA 65

  Fly    51 CCL-ICDLPLECMAGDFLRVVQEIQRHSLGAFSPWFNLPECLLEGMRSWLPEDAHLLASGRLHIS 114
            ..| :....|:........:...:.....||.:|.:.|.|.|:..:..:||.|. ..|.||||||
 Worm    66 AILALAPEKLDAAIDTLYSMADHVHAQRFGAMTPGYYLNEQLVTIIDDFLPTDI-ANAQGRLHIS 129

  Fly   115 LTRVSDRRNVVMSEFSSRQELLQALMCSCFIP----GLSGLVPPQVRGVRYMDGAFSDNLPLL-D 174
            :|::....|:::::|.||..|:..|:.||:||    |..| |||.:.....:||..::|||.. |
 Worm   130 ITKLKKWENIMINKFDSRDHLISCLLASCYIPMYSMGYKG-VPPIINQEECIDGGMTNNLPTFPD 193

  Fly   175 EHTVTVSPFCGESDICPRDQNPHLLQLNINWANTCIRLSRRNLRRMVRILVPGRADFMANFCQQG 239
            ..|:|.|||..::||||.|.:    ..||.:.....:.|||||.|..|.|.|.....:..:.:.|
 Worm   194 VLTITCSPFSSQADICPDDPS----TWNIEFGKQIFKASRRNLYRGARALFPPNRFILKQYYEMG 254

  Fly   240 YDDTLQFLRRN 250
            ..|...|:::|
 Worm   255 ISDADIFIKKN 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dobNP_572995.1 Pat_iPLA2 7..253 CDD:132857 88/252 (35%)
EIN3 <270..>375 CDD:296674
D1054.1NP_505749.3 Pat_PNPLA4 21..266 CDD:132861 88/251 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3773
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1204225at2759
OrthoFinder 1 1.000 - - FOG0000670
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17075
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.