DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and ERV25

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_013701.1 Gene:ERV25 / 854997 SGDID:S000004473 Length:211 Species:Saccharomyces cerevisiae


Alignment Length:243 Identity:58/243 - (23%)
Similarity:98/243 - (40%) Gaps:50/243 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQAIWLGMPGLVLLLSIAALLLGVQDAEAYDKEMTVYVDAGKTECLYHSVRQGETIDFEYQVIDG 65
            ||.:.|.:..|:.|: :|...|....|.:.|.|..         |:...|.:|:.:..:.. .||
Yeast     1 MQVLQLWLTTLISLV-VAVQGLHFDIAASTDPEQV---------CIRDFVTEGQLVVADIH-SDG 54

  Fly    66 GHGD-LDISFTLLDPIGLVIVSDFKKPENVHRHEVAKEGDYR------------FCFDNSFSMFN 117
            ..|| ..::..:.|.:|           |.:|.:....||.|            .||:|......
Yeast    55 SVGDGQKLNLFVRDSVG-----------NEYRRKRDFAGDVRVAFTAPSSTAFDVCFENQAQYRG 108

  Fly   118 RK-TVFFELIVEREGEELQGDTQWNEADELTGLSRDEYYDMKVQDIMDFIGRIRLQLTKARQLQD 181
            |. :...||.:| .|.|.:   .||:......|...|....:|::|.|   .|..:||       
Yeast   109 RSLSRAIELDIE-SGAEAR---DWNKISANEKLKPIEVELRRVEEITD---EIVDELT------- 159

  Fly   182 VLRSHEARDRNLAESNFQKVNHWSMVQISAMIGVGLIQVFMLRSIFAT 229
            .|::.|.|.|:..||..::|.::|::.|..:..:|:.||..|::.|.|
Yeast   160 YLKNREERLRDTNESTNRRVRNFSILVIIVLSSLGVWQVNYLKNYFKT 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 47/207 (23%)
ERV25NP_013701.1 EMP24_GP25L 20..206 CDD:395878 50/220 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.