DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and ERP6

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_011513.1 Gene:ERP6 / 852882 SGDID:S000002970 Length:216 Species:Saccharomyces cerevisiae


Alignment Length:223 Identity:53/223 - (23%)
Similarity:86/223 - (38%) Gaps:58/223 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LSIAALLLGVQDAEAYDKEMTVYVDAGKTECLYHSVRQGETIDFEYQVIDGGHGDL--------D 71
            ||...||.|..:.|.||.::..|......:       .|..||.| :|.|..|..:        |
Yeast    36 LSKDTLLKGSYNLEVYDDKLADYALPSYND-------YGIVIDVE-EVFDNNHRVVHQQGSPSGD 92

  Fly    72 ISFTLLDPIGLVIVSDFKKPENVHRHEVAKEGDYRFCFDNSFSMFNRKTVFFELIVERE-GEELQ 135
            .||..|:                       .|:|:.|..:..:.:..||. .:|.:|.| |.|..
Yeast    93 FSFLALE-----------------------SGEYKICLQSRVNNWVGKTK-TKLEIEFEVGFEAM 133

  Fly   136 GDTQWNEA-DELTGLSRDEYYDMKVQDIMDFIGRIRLQLTKARQLQDVLRSHEARDRNLAESNFQ 199
            .|.|..|. :.|.|  :....:.|:.||              |:.|.::|..|...|:::||...
Yeast   134 LDMQRKETLESLHG--KVSILNSKIVDI--------------RREQQLMREREESFRDISESVNS 182

  Fly   200 KVNHWSMVQISAMIGVGLIQVFMLRSIF 227
            :...|::.|::.:|.:.:.|:..|||.|
Yeast   183 RAMWWTVTQVTLLIIICVWQMKSLRSFF 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 44/203 (22%)
ERP6NP_011513.1 EMP24_GP25L 19..210 CDD:395878 52/221 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.