DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and ERP3

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_010266.1 Gene:ERP3 / 851544 SGDID:S000002176 Length:225 Species:Saccharomyces cerevisiae


Alignment Length:257 Identity:60/257 - (23%)
Similarity:90/257 - (35%) Gaps:97/257 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 AEAYDKEMTVYVDAGKTECLYHSVRQGE-TIDFEYQVIDGGHGDLDISFTLLDPIGLVIVSDFKK 90
            |||  ..:|..::.|:.||||....:.: ||.:.:.|..|...|.|:::.:..|      .|..|
Yeast    19 AEA--SPLTFELNKGRKECLYTLTPEIDCTISYYFAVQQGESNDFDVNYEIFAP------DDKNK 75

  Fly    91 PENVHRHEVAKEGDYRFCFDNSFSMFNRKTVFFELIVEREGEELQGDTQWNEADELTGLSRDEY- 154
            |                                  |:||.||. ||  :|:    ..|..:.|| 
Yeast    76 P----------------------------------IIERSGER-QG--EWS----FIGQHKGEYA 99

  Fly   155 ---YDMKVQD-IMDFIGR--------IRLQLTKARQLQDVLRSHEA---------------RDRN 192
               |..|..| |:|...:        ||.:..|||:.|..||..:.               |..:
Yeast   100 ICFYGGKAHDKIVDLDFKYNCERQDDIRNERRKARKAQRNLRDSKTDPLQDSVENSIDTIERQLH 164

  Fly   193 LAESNFQKV------NH------------WSMVQISAMIGVGLIQVFMLRSIFATGGRMHNL 236
            :.|.|.|..      ||            :|:..|..:||:...|:.:|..||.. .|.||:
Yeast   165 VLERNIQYYKSRNTRNHHTVCSTEHRIVMFSIYGILLIIGMSCAQIAILEFIFRE-SRKHNV 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 52/240 (22%)
ERP3NP_010266.1 EMP24_GP25L 23..218 CDD:395878 53/241 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.