DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and p24delta5

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_173608.1 Gene:p24delta5 / 838792 AraportID:AT1G21900 Length:216 Species:Arabidopsis thaliana


Alignment Length:226 Identity:44/226 - (19%)
Similarity:92/226 - (40%) Gaps:37/226 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLLSIAALLLGVQDAEAYDKEMTVYVDAGKTECLYHSVRQGETIDFEYQVIDGGHGDLD--ISFT 75
            |.|::....|.|...||.  .:|:....| |:|:...::....:..:|.|:|..:.:..  :|..
plant    11 LFLTVVLFFLTVNYGEAI--WLTIPTTGG-TKCVSEEIQSNVVVLADYYVVDEHNPENTPAVSSK 72

  Fly    76 LLDPIGLVIVSDFKKPENVHRHEVA----KEGDYRFCF--DNSFSMFNRKTVFFELIVEREGEEL 134
            :..|.|    ::....|||...:.|    :.|:|..||  |:|..:.|..|:             
plant    73 VTSPYG----NNLHHQENVTHGQFAFTTQEAGNYLACFWIDSSHHLANPITL------------- 120

  Fly   135 QGDTQWN---EADELTGLSRDEYYDMKVQDIMDFIGRIRLQLTKARQLQDVLRSHEARDRNLAES 196
              ...|.   .|.:...:::.|    |::.:...:.|:...:...|:..:.::..||..|.::|:
plant   121 --GVDWKMGIAAKDWDSVAKKE----KIEGVELQLRRLEGLVLSIRENLNYIKDREAEMREVSET 179

  Fly   197 NFQKVNHWSMVQISAMIGVGLIQVFMLRSIF 227
            ...:|..:|::.:...:.|...|:..|:..|
plant   180 TNSRVAWFSIMSLGVCVVVVGSQILYLKRYF 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 37/204 (18%)
p24delta5NP_173608.1 EMP24_GP25L 27..210 CDD:279450 38/208 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.