DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and p24beta2

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_187425.1 Gene:p24beta2 / 819959 AraportID:AT3G07680 Length:208 Species:Arabidopsis thaliana


Alignment Length:254 Identity:62/254 - (24%)
Similarity:102/254 - (40%) Gaps:66/254 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LGMPGLVLLLSIA---ALLLGVQDAEAYDKEMTVYVDAGKTECLYHSVR-QGETIDFEYQVIDGG 66
            :.:.|.::||.:.   ...||::  ...|:|          ||..|... :|:|:...:.||   
plant     1 MSLKGTIVLLGLLWSFQATLGIR--FVIDRE----------ECFSHKAEYEGDTLHVSFVVI--- 50

  Fly    67 HGDLDISFTLLDPIGLVI-------VSDFKKPENV-HRHEVAKEGDYRFCFDNSFSMFNRKTVFF 123
            ..|....|. .|.:.|||       :.||::..:. |...|.|:|.|||||.|       |:.:.
plant    51 KSDSQWHFN-EDGVDLVIHGPTGEQIHDFREQISAKHDFVVQKKGVYRFCFTN-------KSPYH 107

  Fly   124 ELIVEREGEELQGDTQWNEADELTGLSRDEYYDMKVQD-----IMDFIGRIRLQLTKARQLQDVL 183
            |.|        ..|.|         |....|||...:|     :|:.|.::...|...:..|..|
plant   108 ETI--------DFDVQ---------LGHFAYYDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWL 155

  Fly   184 RSHEARDRNLAESNFQKVNHWSMVQISAMIGVGLIQVFMLRSIFATGGRMHNLWRKLGI 242
            .:...|...:.|:..::..|.::.:..|:||...:||::||.:|.         ||||:
plant   156 EAQTDRQAIVNENMSKRAVHKALFESFALIGASFLQVYLLRRLFE---------RKLGM 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 51/207 (25%)
p24beta2NP_187425.1 EMP24_GP25L 21..200 CDD:279450 53/218 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.