DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and Tmed5

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_083152.1 Gene:Tmed5 / 73130 MGIID:1921586 Length:229 Species:Mus musculus


Alignment Length:225 Identity:92/225 - (40%)
Similarity:140/225 - (62%) Gaps:9/225 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IWLGMPGLVLLLSIAALLLGVQD-AEAYDKEMTVYVDAGKTECLYHSVRQGETIDFEYQVIDGGH 67
            :||..|.|:|....||||.|... ..:.|.:.|..:.||:.||.|..:....:::.||||:||  
Mouse     5 MWLPFPVLLLSALPAALLRGAAGFTPSLDSDFTFTLPAGRKECFYQPMPLKASLEIEYQVLDG-- 67

  Fly    68 GDLDISFTLLDPIGLVIVSDFKKPENVHRHEVAKEGDYRFCFDNSFSMFNRKTVFFELIVEREGE 132
            |:|||.|.|..|.|..:|.:.:|.:.||..| .::|||.|||||:||..:.|.:|||||::..||
Mouse    68 GELDIDFHLTSPEGRTLVFEQRKSDGVHTIE-TEDGDYMFCFDNTFSTISEKVIFFELILDNMGE 131

  Fly   133 ELQGDTQWNEADELTGLSRDEYYDMKVQDIMDFIGRIRLQLTKARQLQDVLRSHEARDRNLAESN 197
            |:||...|.:.     ::..:..:||::||::.|..|:.:|:|:..:|.:||:.||||||:.|||
Mouse   132 EVQGQEDWKKY-----ITNTDVLEMKLEDILESINSIKSRLSKSGHIQTLLRAFEARDRNIQESN 191

  Fly   198 FQKVNHWSMVQISAMIGVGLIQVFMLRSIF 227
            |.:||.||:|.:..|:.|..|||:.|:|:|
Mouse   192 FDRVNFWSVVNLMVMVVVSAIQVYTLKSLF 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 80/193 (41%)
Tmed5NP_083152.1 EMP24_GP25L 35..222 CDD:279450 81/195 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 163 1.000 Domainoid score I3945
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4996
Inparanoid 1 1.050 175 1.000 Inparanoid score I4053
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49398
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 1 1.000 - - mtm8870
orthoMCL 1 0.900 - - OOG6_108563
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1790
SonicParanoid 1 1.000 - - X1510
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.