DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and Tmed11

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_001071744.1 Gene:Tmed11 / 689712 RGDID:1588776 Length:214 Species:Rattus norvegicus


Alignment Length:206 Identity:42/206 - (20%)
Similarity:81/206 - (39%) Gaps:31/206 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 YVDAGKTE--CLYHSVRQGETI--DFEYQVID-GGHGDLDIS-----FTLLDPIGLVIVSDFKKP 91
            |..||:.|  |:...:.....|  .|:.|..| |.|..|:.:     |..:.....|::|.....
  Rat    19 YFHAGEREEKCIIEDIPSDTLITGTFKIQQWDIGRHDFLESAPGLGMFVTVTNNDEVLLSKLYGA 83

  Fly    92 ENVHRHEVAKEGDYRFCFDNSFSMF-----NRKTVFFELIVEREGEELQGDTQWNEADELTGLSR 151
            :..........|::..|.:::.:.|     ::..:..::   |.||        ::.|.:...::
  Rat    84 QGTFYFTSHSSGEHIICLESNSTQFVSFGGSKLRIHLDI---RVGE--------HDLDAVIVQAK 137

  Fly   152 DEYYDMKVQDIMDFIGRIRLQLTKARQLQDVLRSHEARDRNLAESNFQKVNHWSMVQISAMIGVG 216
            |     ||.::...:..:..|:.:..:.||..|..|...|..:|...:.|..|:..||...|.||
  Rat   138 D-----KVNEVAFTLRHLIEQIEQILKEQDYQRDREENFRITSEDTNRNVLWWAFAQILIFISVG 197

  Fly   217 LIQVFMLRSIF 227
            :.|:..|:..|
  Rat   198 IFQMKHLKDFF 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 41/204 (20%)
Tmed11XP_001071744.1 EMP24_GP25L 17..208 CDD:395878 41/204 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344440
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.