DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and Tmed7

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_079974.1 Gene:Tmed7 / 66676 MGIID:1913926 Length:224 Species:Mus musculus


Alignment Length:213 Identity:65/213 - (30%)
Similarity:102/213 - (47%) Gaps:21/213 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IAALLLGVQDAEAYDKEMTVYVDAGKTECLYHSVRQGETIDFEYQVIDGGHGDLDISFTLLDPIG 81
            :.|||| :..|.:...|:|..:.....:|.|..:.||.....|:|||.|||.|:|.  .|.||.|
Mouse    21 LLALLL-LLPAPSGGSEITFELPDNAKQCFYEDITQGTKCTLEFQVITGGHYDVDC--RLEDPDG 82

  Fly    82 LVIVSDFKKPENVHRHEVAKEGDYRFCFDNSFSMFNRKTVFFELIVEREGEELQGDTQWNEADEL 146
            .|:..:.||..:......::.|.|:|||.|.||.|..|||:|:..|   ||:.......|....|
Mouse    83 KVLYKEMKKQYDSFTFTASRNGTYKFCFSNEFSTFTHKTVYFDFQV---GEDPPLFPSENRVSAL 144

  Fly   147 TGL-SRDEYYDMKVQDIMDFIGRIRLQLTKARQLQDVLRSHEARDRNLAESNFQKVNHWSMVQIS 210
            |.: |........::.::|:....||:              ||:.|:.||....:|.:||:.:..
Mouse   145 TQMESACVSIHEALKSVIDYQTHFRLR--------------EAQGRSRAEDLNTRVAYWSVGEAL 195

  Fly   211 AMIGVGLIQVFMLRSIFA 228
            .::.|.:.|||:|:|.|:
Mouse   196 ILLVVSVGQVFLLKSFFS 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 59/194 (30%)
Tmed7NP_079974.1 EMP24_GP25L 36..213 CDD:307313 59/195 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1292519at2759
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1790
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.