DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and Tmed6

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_079734.1 Gene:Tmed6 / 66269 MGIID:1913519 Length:239 Species:Mus musculus


Alignment Length:236 Identity:57/236 - (24%)
Similarity:92/236 - (38%) Gaps:33/236 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVLLLSIAALLLGVQDAE---------------AYDKEMTVYVDAGKTECLYHSVRQGETIDFEY 60
            ||..|.:.:|:..|:..|               |...:..:.|..|..||.:....|...:.|.|
Mouse     6 LVAELVVLSLVTSVKSQETDPLHGSKDQPLFRGADRNDFAIVVSPGAIECFWQFADQMGYLYFSY 70

  Fly    61 QV--IDGGHGDLDISFTLLDPIGLVI--VSDFKKPENVHRHEVAKEGDYRFCFDNSFSMFNRKTV 121
            :|  |.|...|..|..|...|.|.:|  ..|.:...|....|.   |.|:.|..|..:.|:...|
Mouse    71 EVQRILGMSHDRHIVATAHTPQGFLIDTSQDVRGQINFATQET---GFYQLCLKNEQNRFSSIQV 132

  Fly   122 FFELIVEREGEELQGDTQWNEADELTGLSRDEYYDMKVQDIMDFIGRIRLQLTKARQLQDVLRSH 186
            :....|..||.|:  |.:.::..:|..         .:..|.|...|:..|:....:..:..|..
Mouse   133 YLNFGVFYEGPEV--DHKQSQRKQLND---------TLDAIKDSTQRVENQVFHMWRFYNYARMR 186

  Fly   187 EARDRNLAESNFQKVNHWSMVQISAMIGVGLIQVFMLRSIF 227
            :..|..|.:||:..||.||..|..|::..|.:|::.|:.:|
Mouse   187 KVADFFLLQSNYTYVNWWSTAQSLAIVLSGALQLYFLKRLF 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 49/197 (25%)
Tmed6NP_079734.1 EMP24_GP25L 43..227 CDD:279450 49/197 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.