DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and tmed9

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_005173235.1 Gene:tmed9 / 613145 ZFINID:ZDB-GENE-050417-434 Length:223 Species:Danio rerio


Alignment Length:211 Identity:47/211 - (22%)
Similarity:85/211 - (40%) Gaps:43/211 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LLLGVQDAEAYDKEMTVYVDAGKTECLYHSVRQGETIDFEYQVIDGGHGDLDISFTLLDPIGLVI 84
            :::|....:.|||:...|:.|          .||                |.:...:.||...||
Zfish    47 MIIGNYRTQLYDKQKEEYLPA----------TQG----------------LGMFVEVKDPDEKVI 85

  Fly    85 VSDFKKPENVHRHEVAKEGDYRFCF---DNSFSMFNRKTVFFELIVEREGEELQGDTQWNEADEL 146
            :|.....|..........|:::.|.   .:.|::|....:...|.:: .||......:....|:|
Zfish    86 LSRQYGSEGRFIFTSHTPGEHQICLHSNSSKFALFAGGMLRVHLDIQ-VGEHTNNYAEIAAKDKL 149

  Fly   147 TGLSRDEYYDMKVQDIMDFIGRIRLQLTKARQLQDVLRSHEARDRNLAESNFQKVNHWSMVQISA 211
            |.|      .::|:.:|:.:.:|:.:       |:..|..|.|.|..:||..|:|..||:||...
Zfish   150 TEL------QLRVRQLMEQVDQIQKE-------QNYQRYREERFRQTSESTNQRVLWWSIVQTLI 201

  Fly   212 MIGVGLIQVFMLRSIF 227
            ::.:|..|:..|:|.|
Zfish   202 LVAIGFWQMRHLKSFF 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 42/196 (21%)
tmed9XP_005173235.1 EMP24_GP25L 25..218 CDD:279450 47/211 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.