DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and tmed10

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001016258.1 Gene:tmed10 / 549012 XenbaseID:XB-GENE-968508 Length:207 Species:Xenopus tropicalis


Alignment Length:235 Identity:46/235 - (19%)
Similarity:88/235 - (37%) Gaps:57/235 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VLLLSIAALLLGVQDAEAYDKEMTVYVDAGKTECLYHSVRQGETIDFEYQVIDGGHGDLDISFTL 76
            :|.:..|.|..|      |.:.::..:.....:||...:.:...:..||::.: .|....:...:
 Frog     4 LLPVLFALLFCG------YVQPISFSLPPNSRKCLREEIHKNVLVTGEYELSE-AHNQGQVRLKI 61

  Fly    77 LDPIGLVIVSDFKKPENVHRHEVAKEGDYRF----------CFDNSF---------SMFNRKTVF 122
            .|..|.::.|          .|.|.:|.:.|          |||:..         .|.|     
 Frog    62 TDSAGHILYS----------KEDASKGKFAFTTEEYDMFEVCFDSKLPAGAGRVPDQMVN----- 111

  Fly   123 FELIVEREGEELQGDTQWNEADELTGLSRDEYYDMKVQDIMDFIGRIRLQLTKARQLQDVLRSHE 187
               ::.:.|.|.:...:..:.::|..|   |....:::|:.:.|......:.|        |..|
 Frog   112 ---LIMKHGVEAKNYEEIAKVEKLKPL---EVELRRLEDLSESIVNDFAYMKK--------REEE 162

  Fly   188 ARDRNLAESNFQKVNHWSMVQISAMIGVGLIQVFMLRSIF 227
            .||.|  ||...:|.::|:..:..::|:...|||.||..|
 Frog   163 MRDTN--ESTNVRVLYFSIFSMCCLMGLATWQVFYLRRFF 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 40/212 (19%)
tmed10NP_001016258.1 EMP24_GP25L 19..201 CDD:366467 41/214 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.