DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and TMED7

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_861974.1 Gene:TMED7 / 51014 HGNCID:24253 Length:224 Species:Homo sapiens


Alignment Length:227 Identity:68/227 - (29%)
Similarity:105/227 - (46%) Gaps:26/227 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WLGMPGL--VLLLSIAALLLGVQDAEAYDKEMTVYVDAGKTECLYHSVRQGETIDFEYQVIDGGH 67
            |..:.|.  ..||::..|:.|...|    .|:|..:.....:|.|..:.||.....|:|||.|||
Human    10 WAAVAGRWGCRLLALLLLVPGPGGA----SEITFELPDNAKQCFYEDIAQGTKCTLEFQVITGGH 70

  Fly    68 GDLDISFTLLDPIGLVIVSDFKKPENVHRHEVAKEGDYRFCFDNSFSMFNRKTVFFELIVEREGE 132
            .|:|.  .|.||.|.|:..:.||..:......:|.|.|:|||.|.||.|..|||:|:..|   ||
Human    71 YDVDC--RLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTFTHKTVYFDFQV---GE 130

  Fly   133 ELQGDTQWNEADELTGL-SRDEYYDMKVQDIMDFIGRIRLQLTKARQLQDVLRSHEARDRNLAES 196
            :.......|....||.: |........::.::|:....||:              ||:.|:.||.
Human   131 DPPLFPSENRVSALTQMESACVSIHEALKSVIDYQTHFRLR--------------EAQGRSRAED 181

  Fly   197 NFQKVNHWSMVQISAMIGVGLIQVFMLRSIFA 228
            ...:|.:||:.:...::.|.:.|||:|:|.|:
Human   182 LNTRVAYWSVGEALILLVVSIGQVFLLKSFFS 213

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 60/194 (31%)
TMED7NP_861974.1 EMP24_GP25L 36..213 CDD:307313 60/195 (31%)
COPI vesicle coat-binding. /evidence=ECO:0000255 211..224 1/3 (33%)