DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment opm and TMED5

DIOPT Version :9

Sequence 1:NP_572994.1 Gene:opm / 32435 FlyBaseID:FBgn0264389 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_057124.3 Gene:TMED5 / 50999 HGNCID:24251 Length:229 Species:Homo sapiens


Alignment Length:225 Identity:93/225 - (41%)
Similarity:135/225 - (60%) Gaps:9/225 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IWLGMPGLVLLLSIAALLLGVQD-AEAYDKEMTVYVDAGKTECLYHSVRQGETIDFEYQVIDGGH 67
            |||..|.|:|......||.|... ..:.|.:.|..:.||:.||.|..:....:::.||||:||  
Human     5 IWLPFPVLLLAALPPVLLPGAAGFTPSLDSDFTFTLPAGQKECFYQPMPLKASLEIEYQVLDG-- 67

  Fly    68 GDLDISFTLLDPIGLVIVSDFKKPENVHRHEVAKEGDYRFCFDNSFSMFNRKTVFFELIVEREGE 132
            ..|||.|.|..|.|..:|.:.:|.:.||..| .:.|||.|||||:||..:.|.:|||||::..||
Human    68 AGLDIDFHLASPEGKTLVFEQRKSDGVHTVE-TEVGDYMFCFDNTFSTISEKVIFFELILDNMGE 131

  Fly   133 ELQGDTQWNEADELTGLSRDEYYDMKVQDIMDFIGRIRLQLTKARQLQDVLRSHEARDRNLAESN 197
            :.|....|.:  .:||   .:..|||::||::.|..|:.:|:|:..:|.:||:.||||||:.|||
Human   132 QAQEQEDWKK--YITG---TDILDMKLEDILESINSIKSRLSKSGHIQTLLRAFEARDRNIQESN 191

  Fly   198 FQKVNHWSMVQISAMIGVGLIQVFMLRSIF 227
            |.:||.||||.:..|:.|..|||:||:|:|
Human   192 FDRVNFWSMVNLVVMVVVSAIQVYMLKSLF 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
opmNP_572994.1 EMP24_GP25L 33..227 CDD:279450 82/193 (42%)
TMED5NP_057124.3 EMP24_GP25L 35..222 CDD:279450 83/195 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 157 1.000 Domainoid score I4153
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4996
Inparanoid 1 1.050 167 1.000 Inparanoid score I4166
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49398
OrthoDB 1 1.010 - - D1292519at2759
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 1 1.000 - - mtm8638
orthoMCL 1 0.900 - - OOG6_108563
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1790
SonicParanoid 1 1.000 - - X1510
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.870

Return to query results.
Submit another query.